Gene Gene information from NCBI Gene database.
Entrez ID 84572
Gene name N-acetylglucosamine-1-phosphate transferase subunit gamma
Gene symbol GNPTG
Synonyms (NCBI Gene)
C16orf27GNPTAGLP2537RJD9
Chromosome 16
Chromosome location 16p13.3
Summary This gene encodes the gamma sunbunit of the N-acetylglucosamine-1-phosphotransferase complex. This hexameric complex, composed of alpha, beta and gamma subunits, catalyzes the first step in synthesis of a mannose 6-phosphate lysosomal recognition marker.
SNPs SNP information provided by dbSNP.
31
SNP ID Visualize variation Clinical significance Consequence
rs76594024 G>A,C Conflicting-interpretations-of-pathogenicity, uncertain-significance Synonymous variant, 5 prime UTR variant, coding sequence variant
rs112850896 G>A,C Likely-pathogenic Splice acceptor variant
rs137852884 G>A Pathogenic 5 prime UTR variant, coding sequence variant, stop gained
rs137852885 G>A Pathogenic 5 prime UTR variant, coding sequence variant, missense variant
rs193302847 G>A,C Likely-pathogenic, pathogenic Splice acceptor variant
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 26385638, 28514442
GO:0005576 Component Extracellular region IEA
GO:0005794 Component Golgi apparatus IBA
GO:0005794 Component Golgi apparatus IDA 27038293
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607838 23026 ENSG00000090581
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UJJ9
Protein name N-acetylglucosamine-1-phosphotransferase subunit gamma (GlcNAc-1-phosphotransferase subunit gamma) (UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma)
Protein function Non-catalytic subunit of the N-acetylglucosamine-1-phosphotransferase complex, an enzyme that catalyzes the formation of mannose 6-phosphate (M6P) markers on high mannose type oligosaccharides in the Golgi apparatus. Binds and presents the high
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13015 PRKCSH_1 48 211 Glucosidase II beta subunit-like protein Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10712439}.
Sequence
MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSG
PVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTG
MWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTL
PEALQRQWDQVEQDLADELITPQGHEKLLRT
LFEDAGYLKTPEENEPTQLEGGPDSLGFE
TLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPG
LRGSL
Sequence length 305
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Lysosome  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
18
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Familial cancer of breast Likely pathogenic rs2141632749 RCV005912612
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
GNPTG-mucolipidosis Likely pathogenic; Pathogenic rs2141632749, rs988175540, rs1451538466, rs2141861740, rs552402857, rs193302858, rs2141864418, rs368983807, rs2548190467, rs2548185540, rs771844889, rs193302856, rs1335120510, rs193302859, rs137852884
View all (39 more)
RCV005014520
RCV001831373
RCV004770133
RCV001843409
RCV004776305
View all (55 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Melanoma Pathogenic rs112850896 RCV005924378
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mucolipidosis Likely pathogenic rs1060499690, rs1596603769 RCV000825527
RCV000825528
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GNPTG-related disorder Likely benign; Benign; Conflicting classifications of pathogenicity; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Aortic Valve Insufficiency Aortic Valve Insufficiency HPO_DG
★☆☆☆☆
Found in Text Mining only
Aortic Valve Stenosis Aortic Valve Sclerosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 39864423 Associate
★☆☆☆☆
Found in Text Mining only
Congenital pectus carinatum Congenital Pectus Carinatum HPO_DG
★☆☆☆☆
Found in Text Mining only
Dwarfism Dwarfism HPO_DG
★☆☆☆☆
Found in Text Mining only
Dyslexia Dyslexia BEFREE 25643770
★☆☆☆☆
Found in Text Mining only
Mild Mental Retardation Mental retardation HPO_DG
★☆☆☆☆
Found in Text Mining only
Mucolipidoses Mucolipidosis BEFREE 22884963, 26935170, 30882951
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Mucolipidoses Mucolipidosis Pubtator 26130485, 27038293, 29872134, 35939698 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Mucolipidoses Mucolipidosis CLINVAR_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations