Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84539
Gene name	Melanin concentrating hormone receptor 2
Gene symbol	MCHR2
Synonyms (NCBI Gene)	GPR145GPRv17MCH-2RMCH-R2MCH2MCH2RMCHR-2SLT
Chromosome	6
Chromosome location	6q16.2

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018648	hsa-miR-335-5p	Microarray	18185580
MIRT1137155	hsa-miR-3145-5p	CLIP-seq
MIRT1137156	hsa-miR-3691-3p	CLIP-seq
MIRT1137157	hsa-miR-151-3p	CLIP-seq
MIRT1137158	hsa-miR-4662a-5p	CLIP-seq
MIRT1137159	hsa-miR-590-3p	CLIP-seq
MIRT2039036	hsa-miR-106a	CLIP-seq
MIRT2039037	hsa-miR-106b	CLIP-seq
MIRT2039038	hsa-miR-150	CLIP-seq
MIRT2039039	hsa-miR-17	CLIP-seq
MIRT2039040	hsa-miR-20a	CLIP-seq
MIRT2039041	hsa-miR-20b	CLIP-seq
MIRT2039042	hsa-miR-302a	CLIP-seq
MIRT2039043	hsa-miR-302b	CLIP-seq
MIRT2039044	hsa-miR-302c	CLIP-seq
MIRT2039045	hsa-miR-302d	CLIP-seq
MIRT2039046	hsa-miR-302e	CLIP-seq
MIRT2039047	hsa-miR-3130-3p	CLIP-seq
MIRT2039048	hsa-miR-372	CLIP-seq
MIRT2039049	hsa-miR-373	CLIP-seq
MIRT2039050	hsa-miR-4252	CLIP-seq
MIRT2039051	hsa-miR-4438	CLIP-seq
MIRT2039052	hsa-miR-4731-5p	CLIP-seq
MIRT2039053	hsa-miR-5095	CLIP-seq
MIRT2039054	hsa-miR-512-3p	CLIP-seq
MIRT2039055	hsa-miR-519d	CLIP-seq
MIRT2039056	hsa-miR-520a-3p	CLIP-seq
MIRT2039057	hsa-miR-520b	CLIP-seq
MIRT2039058	hsa-miR-520c-3p	CLIP-seq
MIRT2039059	hsa-miR-520d-3p	CLIP-seq
MIRT2039060	hsa-miR-520e	CLIP-seq
MIRT2039061	hsa-miR-520g	CLIP-seq
MIRT2039062	hsa-miR-520h	CLIP-seq
MIRT2039063	hsa-miR-93	CLIP-seq
MIRT2039064	hsa-miR-941	CLIP-seq
MIRT2039036	hsa-miR-106a	CLIP-seq
MIRT2039037	hsa-miR-106b	CLIP-seq
MIRT2039038	hsa-miR-150	CLIP-seq
MIRT2039039	hsa-miR-17	CLIP-seq
MIRT2039040	hsa-miR-20a	CLIP-seq
MIRT2039041	hsa-miR-20b	CLIP-seq
MIRT2269060	hsa-miR-27a	CLIP-seq
MIRT2269061	hsa-miR-27b	CLIP-seq
MIRT2039042	hsa-miR-302a	CLIP-seq
MIRT2039043	hsa-miR-302b	CLIP-seq
MIRT2039044	hsa-miR-302c	CLIP-seq
MIRT2039045	hsa-miR-302d	CLIP-seq
MIRT2039046	hsa-miR-302e	CLIP-seq
MIRT2039047	hsa-miR-3130-3p	CLIP-seq
MIRT2269062	hsa-miR-3187-3p	CLIP-seq
MIRT2039048	hsa-miR-372	CLIP-seq
MIRT2039049	hsa-miR-373	CLIP-seq
MIRT2269063	hsa-miR-380	CLIP-seq
MIRT2039050	hsa-miR-4252	CLIP-seq
MIRT2269064	hsa-miR-4435	CLIP-seq
MIRT2039051	hsa-miR-4438	CLIP-seq
MIRT2269065	hsa-miR-4463	CLIP-seq
MIRT2269066	hsa-miR-4464	CLIP-seq
MIRT2269067	hsa-miR-4494	CLIP-seq
MIRT2269068	hsa-miR-4666-5p	CLIP-seq
MIRT2269069	hsa-miR-4701-5p	CLIP-seq
MIRT2039052	hsa-miR-4731-5p	CLIP-seq
MIRT2269070	hsa-miR-4748	CLIP-seq
MIRT2269071	hsa-miR-4781-3p	CLIP-seq
MIRT2269072	hsa-miR-490-5p	CLIP-seq
MIRT2039053	hsa-miR-5095	CLIP-seq
MIRT2039054	hsa-miR-512-3p	CLIP-seq
MIRT2269073	hsa-miR-513a-5p	CLIP-seq
MIRT2039055	hsa-miR-519d	CLIP-seq
MIRT2039056	hsa-miR-520a-3p	CLIP-seq
MIRT2039057	hsa-miR-520b	CLIP-seq
MIRT2039058	hsa-miR-520c-3p	CLIP-seq
MIRT2039059	hsa-miR-520d-3p	CLIP-seq
MIRT2039060	hsa-miR-520e	CLIP-seq
MIRT2039061	hsa-miR-520g	CLIP-seq
MIRT2039062	hsa-miR-520h	CLIP-seq
MIRT2269074	hsa-miR-548s	CLIP-seq
MIRT2269075	hsa-miR-588	CLIP-seq
MIRT2039063	hsa-miR-93	CLIP-seq
MIRT2039064	hsa-miR-941	CLIP-seq
MIRT2039038	hsa-miR-150	CLIP-seq
MIRT2684735	hsa-miR-640	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004966	Function	Galanin receptor activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
606111	20867	ENSG00000152034

Q969V1

Protein name

Melanin-concentrating hormone receptor 2 (MCH receptor 2) (MCH-R2) (MCHR-2) (G-protein coupled receptor 145) (GPRv17) (MCH-2R) (MCH2) (MCH2R)

Protein function

Receptor for melanin-concentrating hormone, coupled to G proteins that activate phosphoinositide hydrolysis.

PDB

8WST

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	51 → 306	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in the brain, with highest levels in cerebral cortex, hippocampus and amygdala. No expression detected in the cerebellum, thalamus or hypothalamus.

Sequence

MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII
RSRKKTVPDIYICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC
SAIMTVMSVDRYFALVQPFRLTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDG
VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS
VPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS
INPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF

Sequence length

340

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Peptide ligand-binding receptors G alpha (q) signalling events G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	16603725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	19604449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	27306922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	27306922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Binge Eating Disorder	Binge eating disorder	Pubtator	37550530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19502010, 19927306		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	19927306		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35545337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	29955654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	26461262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	19604449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis, Childhood Type	Dermatomyositis	BEFREE	19604449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30583798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Erectile dysfunction	Pubtator	30583798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	1639518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	1629337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	7658263, 8359904		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	19927306		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	19927306		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	19927306		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	19927306		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	19927306		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	19927306		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	19927306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20927318		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31557067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12379219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17698913, 26461262, 29066024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	17698913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38484114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20927318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	17698913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19502010		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19502010		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

MCHR2 (melanin concentrating hormone receptor 2)