Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8453
Gene name	Cullin 2
Gene symbol	CUL2
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10p11.21

251

Show/Hide all (251)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005927	hsa-miR-424-5p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	20972335
MIRT007130	hsa-miR-30c-5p	qRT-PCR	23418453
MIRT052315	hsa-let-7b-5p	CLASH	23622248
MIRT048623	hsa-miR-99a-5p	CLASH	23622248
MIRT048406	hsa-miR-100-5p	CLASH	23622248
MIRT038756	hsa-miR-93-3p	CLASH	23622248
MIRT052839	hsa-miR-4326	CLASH	23622248
MIRT053490	hsa-miR-574-3p	MicroarrayqRT-PCRWestern blot	22683180
MIRT126912	hsa-miR-3163	HITS-CLIP	21572407
MIRT509019	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT509018	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509017	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT558513	hsa-miR-1267	HITS-CLIP	21572407
MIRT509016	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509015	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT509018	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509017	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT509016	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509015	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT126912	hsa-miR-3163	HITS-CLIP	23313552
MIRT509019	hsa-miR-410-3p	HITS-CLIP	23313552
MIRT509015	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT126912	hsa-miR-3163	PAR-CLIP	20371350
MIRT509019	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT509017	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT126912	hsa-miR-3163	PAR-CLIP	21572407
MIRT509019	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509017	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT558513	hsa-miR-1267	PAR-CLIP	21572407
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT126912	hsa-miR-3163	PAR-CLIP	22012620
MIRT509019	hsa-miR-410-3p	PAR-CLIP	22012620
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT509017	hsa-miR-656-3p	PAR-CLIP	22012620
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT126912	hsa-miR-3163	PAR-CLIP	23446348
MIRT509019	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509017	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT126912	hsa-miR-3163	PAR-CLIP	23446348
MIRT509019	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509017	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT727917	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT727916	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT727915	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT727914	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT733748	hsa-miR-154-5p	Luciferase reporter assayqRT-PCRWestern blotting	32742484
MIRT733748	hsa-miR-154-5p	Western blottingMicroarrayqRT-PCR	32742484
MIRT126912	hsa-miR-3163	HITS-CLIP	21572407
MIRT509019	hsa-miR-410-3p	HITS-CLIP	21572407
MIRT509018	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509017	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT558513	hsa-miR-1267	HITS-CLIP	21572407
MIRT509016	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509015	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT509018	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT509017	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT509016	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT509015	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT126912	hsa-miR-3163	HITS-CLIP	23313552
MIRT509019	hsa-miR-410-3p	HITS-CLIP	23313552
MIRT509015	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT126912	hsa-miR-3163	PAR-CLIP	20371350
MIRT509019	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT509017	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT126912	hsa-miR-3163	PAR-CLIP	21572407
MIRT509019	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT509017	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT558513	hsa-miR-1267	PAR-CLIP	21572407
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT126912	hsa-miR-3163	PAR-CLIP	22012620
MIRT509019	hsa-miR-410-3p	PAR-CLIP	22012620
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT509017	hsa-miR-656-3p	PAR-CLIP	22012620
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT126912	hsa-miR-3163	PAR-CLIP	23446348
MIRT509019	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509017	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT126912	hsa-miR-3163	PAR-CLIP	23446348
MIRT509019	hsa-miR-410-3p	PAR-CLIP	23446348
MIRT509018	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT509017	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT509016	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT509015	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT916408	hsa-miR-1251	CLIP-seq
MIRT916409	hsa-miR-1260	CLIP-seq
MIRT916410	hsa-miR-1260b	CLIP-seq
MIRT916411	hsa-miR-1279	CLIP-seq
MIRT916412	hsa-miR-154	CLIP-seq
MIRT916413	hsa-miR-15a	CLIP-seq
MIRT916414	hsa-miR-15b	CLIP-seq
MIRT916415	hsa-miR-16	CLIP-seq
MIRT916416	hsa-miR-188-3p	CLIP-seq
MIRT916417	hsa-miR-1910	CLIP-seq
MIRT916418	hsa-miR-195	CLIP-seq
MIRT916419	hsa-miR-2681	CLIP-seq
MIRT916420	hsa-miR-3122	CLIP-seq
MIRT916421	hsa-miR-3140-3p	CLIP-seq
MIRT916422	hsa-miR-3153	CLIP-seq
MIRT916423	hsa-miR-3156-3p	CLIP-seq
MIRT916424	hsa-miR-3175	CLIP-seq
MIRT916425	hsa-miR-3179	CLIP-seq
MIRT916426	hsa-miR-3180-5p	CLIP-seq
MIRT916427	hsa-miR-338-5p	CLIP-seq
MIRT916428	hsa-miR-3675-3p	CLIP-seq
MIRT916429	hsa-miR-3689a-3p	CLIP-seq
MIRT916430	hsa-miR-3689c	CLIP-seq
MIRT916431	hsa-miR-370	CLIP-seq
MIRT916432	hsa-miR-3913-5p	CLIP-seq
MIRT916433	hsa-miR-424	CLIP-seq
MIRT916434	hsa-miR-4261	CLIP-seq
MIRT916435	hsa-miR-4293	CLIP-seq
MIRT916436	hsa-miR-4446-5p	CLIP-seq
MIRT916437	hsa-miR-4646-5p	CLIP-seq
MIRT916438	hsa-miR-4668-5p	CLIP-seq
MIRT916439	hsa-miR-4756-3p	CLIP-seq
MIRT916440	hsa-miR-4757-3p	CLIP-seq
MIRT916441	hsa-miR-494	CLIP-seq
MIRT916442	hsa-miR-497	CLIP-seq
MIRT916443	hsa-miR-514	CLIP-seq
MIRT916444	hsa-miR-514b-3p	CLIP-seq
MIRT916445	hsa-miR-520a-5p	CLIP-seq
MIRT916446	hsa-miR-525-5p	CLIP-seq
MIRT916447	hsa-miR-596	CLIP-seq
MIRT916448	hsa-miR-642b	CLIP-seq
MIRT916449	hsa-miR-645	CLIP-seq
MIRT916450	hsa-miR-661	CLIP-seq
MIRT916451	hsa-miR-873	CLIP-seq
MIRT916452	hsa-miR-944	CLIP-seq
MIRT1971816	hsa-miR-1257	CLIP-seq
MIRT916409	hsa-miR-1260	CLIP-seq
MIRT916410	hsa-miR-1260b	CLIP-seq
MIRT916416	hsa-miR-188-3p	CLIP-seq
MIRT916417	hsa-miR-1910	CLIP-seq
MIRT916419	hsa-miR-2681	CLIP-seq
MIRT1971817	hsa-miR-30a	CLIP-seq
MIRT1971818	hsa-miR-30b	CLIP-seq
MIRT1971819	hsa-miR-30c	CLIP-seq
MIRT1971820	hsa-miR-30d	CLIP-seq
MIRT1971821	hsa-miR-30e	CLIP-seq
MIRT916421	hsa-miR-3140-3p	CLIP-seq
MIRT916423	hsa-miR-3156-3p	CLIP-seq
MIRT1971822	hsa-miR-329	CLIP-seq
MIRT916427	hsa-miR-338-5p	CLIP-seq
MIRT1971823	hsa-miR-3612	CLIP-seq
MIRT1971824	hsa-miR-3613-5p	CLIP-seq
MIRT1971825	hsa-miR-362-3p	CLIP-seq
MIRT916431	hsa-miR-370	CLIP-seq
MIRT1971826	hsa-miR-4299	CLIP-seq
MIRT1971827	hsa-miR-4443	CLIP-seq
MIRT916436	hsa-miR-4446-5p	CLIP-seq
MIRT1971828	hsa-miR-4645-3p	CLIP-seq
MIRT1971829	hsa-miR-491-3p	CLIP-seq
MIRT916443	hsa-miR-514	CLIP-seq
MIRT916444	hsa-miR-514b-3p	CLIP-seq
MIRT1971830	hsa-miR-522	CLIP-seq
MIRT1971831	hsa-miR-570	CLIP-seq
MIRT1971832	hsa-miR-650	CLIP-seq
MIRT1971833	hsa-miR-656	CLIP-seq
MIRT916451	hsa-miR-873	CLIP-seq
MIRT1971834	hsa-miR-922	CLIP-seq
MIRT916409	hsa-miR-1260	CLIP-seq
MIRT916410	hsa-miR-1260b	CLIP-seq
MIRT2207494	hsa-miR-142-5p	CLIP-seq
MIRT916413	hsa-miR-15a	CLIP-seq
MIRT916414	hsa-miR-15b	CLIP-seq
MIRT916415	hsa-miR-16	CLIP-seq
MIRT916416	hsa-miR-188-3p	CLIP-seq
MIRT916418	hsa-miR-195	CLIP-seq
MIRT916419	hsa-miR-2681	CLIP-seq
MIRT1971817	hsa-miR-30a	CLIP-seq
MIRT1971818	hsa-miR-30b	CLIP-seq
MIRT1971819	hsa-miR-30c	CLIP-seq
MIRT1971820	hsa-miR-30d	CLIP-seq
MIRT1971821	hsa-miR-30e	CLIP-seq
MIRT916421	hsa-miR-3140-3p	CLIP-seq
MIRT916423	hsa-miR-3156-3p	CLIP-seq
MIRT1971822	hsa-miR-329	CLIP-seq
MIRT1971825	hsa-miR-362-3p	CLIP-seq
MIRT916433	hsa-miR-424	CLIP-seq
MIRT1971827	hsa-miR-4443	CLIP-seq
MIRT916436	hsa-miR-4446-5p	CLIP-seq
MIRT916439	hsa-miR-4756-3p	CLIP-seq
MIRT916442	hsa-miR-497	CLIP-seq
MIRT916443	hsa-miR-514	CLIP-seq
MIRT916444	hsa-miR-514b-3p	CLIP-seq
MIRT1971830	hsa-miR-522	CLIP-seq
MIRT2207495	hsa-miR-561	CLIP-seq
MIRT1971831	hsa-miR-570	CLIP-seq
MIRT916451	hsa-miR-873	CLIP-seq
MIRT1971834	hsa-miR-922	CLIP-seq
MIRT1971822	hsa-miR-329	CLIP-seq
MIRT1971825	hsa-miR-362-3p	CLIP-seq
MIRT916431	hsa-miR-370	CLIP-seq
MIRT916408	hsa-miR-1251	CLIP-seq
MIRT916411	hsa-miR-1279	CLIP-seq
MIRT916412	hsa-miR-154	CLIP-seq
MIRT916413	hsa-miR-15a	CLIP-seq
MIRT916414	hsa-miR-15b	CLIP-seq
MIRT916415	hsa-miR-16	CLIP-seq
MIRT916418	hsa-miR-195	CLIP-seq
MIRT2510716	hsa-miR-203	CLIP-seq
MIRT916419	hsa-miR-2681	CLIP-seq
MIRT1971817	hsa-miR-30a	CLIP-seq
MIRT1971818	hsa-miR-30b	CLIP-seq
MIRT1971819	hsa-miR-30c	CLIP-seq
MIRT1971820	hsa-miR-30d	CLIP-seq
MIRT1971821	hsa-miR-30e	CLIP-seq
MIRT1971824	hsa-miR-3613-5p	CLIP-seq
MIRT2510717	hsa-miR-3668	CLIP-seq
MIRT916428	hsa-miR-3675-3p	CLIP-seq
MIRT2510718	hsa-miR-3935	CLIP-seq
MIRT916433	hsa-miR-424	CLIP-seq
MIRT1971826	hsa-miR-4299	CLIP-seq
MIRT2510719	hsa-miR-4666-3p	CLIP-seq
MIRT916442	hsa-miR-497	CLIP-seq
MIRT2510720	hsa-miR-556-5p	CLIP-seq
MIRT1971831	hsa-miR-570	CLIP-seq
MIRT2510721	hsa-miR-616	CLIP-seq
MIRT916449	hsa-miR-645	CLIP-seq
MIRT1971834	hsa-miR-922	CLIP-seq
MIRT916452	hsa-miR-944	CLIP-seq
MIRT1971817	hsa-miR-30a	CLIP-seq
MIRT1971818	hsa-miR-30b	CLIP-seq
MIRT1971819	hsa-miR-30c	CLIP-seq
MIRT1971820	hsa-miR-30d	CLIP-seq
MIRT1971821	hsa-miR-30e	CLIP-seq
MIRT1971824	hsa-miR-3613-5p	CLIP-seq
MIRT1971826	hsa-miR-4299	CLIP-seq
MIRT1971831	hsa-miR-570	CLIP-seq
MIRT1971834	hsa-miR-922	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	8681378
GO:0004842	Function	Ubiquitin-protein transferase activity	TAS
GO:0005515	Function	Protein binding	IPI	12504026, 12609982, 15601820, 17183367, 17304241, 18323857, 18775313, 18826954, 19327355, 21145461, 21778237, 22190034, 22466964, 22939624, 23401859, 23563313, 24192928, 24402281, 25661653, 26906416, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0010498	Process	Proteasomal protein catabolic process	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	TAS
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0031461	Component	Cullin-RING ubiquitin ligase complex	IEA
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IBA
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IDA	17636018
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	17636018
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031981	Component	Nuclear lumen	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	TAS	8681378
GO:0140627	Process	Ubiquitin-dependent protein catabolic process via the C-end degron rule pathway	IDA	29779948
GO:0140627	Process	Ubiquitin-dependent protein catabolic process via the C-end degron rule pathway	IDA	29779948
GO:0160072	Function	Ubiquitin ligase complex scaffold activity	IDA	29779948
GO:0160072	Function	Ubiquitin ligase complex scaffold activity	IEA

MIM	HGNC	e!Ensembl
603135	2552	ENSG00000108094

Q13617

Protein name

Cullin-2 (CUL-2)

Protein function

Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins (PubMed:11384984, PubMed:26138980, PubMed:29775578, PubMed:29779948,

PDB

4WQO , 5N4W , 6R6H , 6R7F , 6R7H , 6R7I , 6R7N , 7PLO , 8IJ1 , 8JAL , 8JAQ , 8JAR , 8JAS , 8JAU , 8JAV , 8JE1 , 8JE2 , 8PQL , 8Q7R , 8QU8 , 8R5H , 8RWZ , 8RX0 , 8WDK , 8WQA , 8WQB , 8WQC , 8WQE , 8WQF , 8WQG , 8WQH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00888	Cullin	14 → 644	Cullin family	Family
PF10557	Cullin_Nedd8	675 → 737	Cullin protein neddylation domain	Domain

Sequence

MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTE
TKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTE
ADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKV
IHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVL
GRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVL
LRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNG
DQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFIT
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDM
SVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMF
ELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQ
DSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKD
TPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKK
CIEVLIDKQYIERSQASADEYSYVA

Sequence length

745

Interactions

View interactions

	KEGG		Reactome
	HIF-1 signaling pathway Ubiquitin mediated proteolysis Pathways in cancer Renal cell carcinoma		Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Moyamoya angiopathy	Likely pathogenic	rs2084869461	RCV004704488	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (40)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	20078552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20712528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	29475926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10487688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	39519104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20680678, 31374029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31374029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27153550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20078552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25540389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35650603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	11526493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20078552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29475926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10441001, 11526493, 24969085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	20712528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	20712528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35111402, 36168628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	9447969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	21983784		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29991678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20078552, 29844124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31374029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20712528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20078552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10487688, 11278610, 17609271, 27153550, 29844124, 30151737, 9122164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30864705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10487688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	24969085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	40413536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11526493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17609271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	17609271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20712528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26152289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37695034	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27153550	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34031216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	14612903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	10487688, 11278610, 11865071, 17967880, 24969085, 9681855		★★★★★ ★☆☆☆☆ Found in Text Mining only

CUL2 (cullin 2)