Gene Gene information from NCBI Gene database.
Entrez ID 84524
Gene name Zinc finger CCCH-type containing 8
Gene symbol ZC3H8
Synonyms (NCBI Gene)
Fliz1ZC3HDC8
Chromosome 2
Chromosome location 2q14.1
miRNA miRNA information provided by mirtarbase database.
156
miRTarBase ID miRNA Experiments Reference
MIRT044954 hsa-miR-186-5p CLASH 23622248
MIRT662145 hsa-miR-34b-3p HITS-CLIP 23824327
MIRT662144 hsa-miR-1910-3p HITS-CLIP 23824327
MIRT662143 hsa-miR-6511a-5p HITS-CLIP 23824327
MIRT662142 hsa-miR-6808-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000791 Component Euchromatin IDA 23932780
GO:0001162 Function RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding IEA
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
621273 30941 ENSG00000144161
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N5P1
Protein name Zinc finger CCCH domain-containing protein 8
Protein function Acts as a transcriptional repressor of the GATA3 promoter. Sequence-specific DNA-binding factor that binds to the 5'-AGGTCTC-3' sequence within the negative cis-acting element intronic regulatory region (IRR) of the GATA3 gene (By similarity). C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00642 zf-CCCH 192 217 Zinc finger C-x8-C-x5-C-x3-H type (and similar) Family
PF18345 zf_CCCH_4 226 244 Domain
PF14608 zf-CCCH_2 248 269 Domain
Sequence
MDFENLFSKPPNPALGKTATDSDERIDDEIDTEVEETQEEKIKLECEQIPKKFRHSAISP
KSSLHRKSRSKDYDVYSDNDICSQESEDNFAKELQQYIQAREMANAAQPEESTKKEGVKD
TPQAAKQKNKNLKAGHKNGKQKKMKRKWPGPGNKGSNALLRNSGSQEEDGKPKEKQQHLS
QAFINQHTVERKGKQICKYFLERKCIKGDQCKFDHDAEIEKKKEMCKFYVQGYCTRGENC
LYLH
NEYPCKFYHTGTKCYQGEYCKFSHAPLTPETQELLAKVLDTEKKSCK
Sequence length 291
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RNA polymerase II transcribes snRNA genes
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
NEUROTIC DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Glioma Glioma Pubtator 34482648 Associate
★☆☆☆☆
Found in Text Mining only