ACTRT3 (actin related protein T3)

Gene

• Entrez ID: 84517
• Gene name: Actin related protein T3
• Gene symbol: ACTRT3
• Synonyms (NCBI Gene): ARP-T3, ARPM1
• Chromosome: 3
• Chromosome location: 3q26.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT496429	hsa-miR-562	PAR-CLIP	22291592
MIRT496428	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT496427	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT496426	hsa-miR-3127-3p	PAR-CLIP	22291592
MIRT496425	hsa-miR-6756-3p	PAR-CLIP	22291592
MIRT496424	hsa-miR-205-5p	PAR-CLIP	22291592
MIRT496423	hsa-miR-6806-5p	PAR-CLIP	22291592
MIRT496422	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT496421	hsa-miR-5007-3p	PAR-CLIP	22291592
MIRT496429	hsa-miR-562	PAR-CLIP	22291592
MIRT496428	hsa-miR-5582-5p	PAR-CLIP	22291592
MIRT496427	hsa-miR-3622a-5p	PAR-CLIP	22291592
MIRT496426	hsa-miR-3127-3p	PAR-CLIP	22291592
MIRT496425	hsa-miR-6756-3p	PAR-CLIP	22291592
MIRT496424	hsa-miR-205-5p	PAR-CLIP	22291592
MIRT496423	hsa-miR-6806-5p	PAR-CLIP	22291592
MIRT496422	hsa-miR-4423-3p	PAR-CLIP	22291592
MIRT496421	hsa-miR-5007-3p	PAR-CLIP	22291592

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	IBA

Other IDs

• MIM: 608534
• HGNC: 24022
• e!Ensembl: ENSG00000184378

Protein

• UniProt ID: Q9BYD9
• Protein name: Actin-related protein T3 (ARP-T3) (Actin-related protein M1)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00022	Actin	4 → 372	Actin	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:11750065}.
• Sequence:

  MNHCQLPVVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDW
  RSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITE
  MFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLA
  GLDLTNYLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMAKKPDCLEKVYQLP
  DGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSSIMKCDTGLRNSFFSNIILAGGS
  TSFPGLDKRLVKDIAKVAPANTAVQVIAPPERKISVWMGGSILASLSAFQDMWITAAEFK
  EVGPNIVHQRCF

• Sequence length: 372

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOID LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT URINARY SYSTEM NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	31089142		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	31089142		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	31089142		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	GWASDB_DG	23583980		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	31089142		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	31089142		★☆☆☆☆ Found in Text Mining only
Plexiform leiomyoma	Plexiform leiomyoma	GWASCAT_DG	31649266		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	GWASCAT_DG	31649266		★☆☆☆☆ Found in Text Mining only