Gene Gene information from NCBI Gene database.
Entrez ID 84516
Gene name Dynactin subunit 5
Gene symbol DCTN5
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16p12.2
Summary This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene
miRNA miRNA information provided by mirtarbase database.
1754
miRTarBase ID miRNA Experiments Reference
MIRT019580 hsa-miR-340-5p Sequencing 20371350
MIRT020007 hsa-miR-375 Microarray 20215506
MIRT023378 hsa-miR-122-5p Microarray 17612493
MIRT051842 hsa-let-7c-5p CLASH 23622248
MIRT045566 hsa-miR-149-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IEA
GO:0003281 Process Ventricular septum development IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612962 24594 ENSG00000166847
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BTE1
Protein name Dynactin subunit 5 (Dynactin subunit p25)
Protein function Part of the dynactin complex that activates the molecular motor dynein for ultra-processive transport along microtubules.
PDB 5NW4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00132 Hexapep 84 118 Bacterial transferase hexapeptide (six repeats) Repeat
PF00132 Hexapep 100 130 Bacterial transferase hexapeptide (six repeats) Repeat
PF00132 Hexapep 107 142 Bacterial transferase hexapeptide (six repeats) Repeat
Sequence
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILD
NTVLPPETVVPP
FTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV
Sequence length 182
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Motor proteins
Vasopressin-regulated water reabsorption
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases
Salmonella infection
  MHC class II antigen presentation
HSP90 chaperone cycle for steroid hormone receptors (SHR)
COPI-mediated anterograde transport
COPI-independent Golgi-to-ER retrograde traffic
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BIPOLAR DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA, COMPLEMENTATION GROUP N Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis, Psoriatic Psoriatic Arthritis BEFREE 25763772
★☆☆☆☆
Found in Text Mining only
Bipolar Disorder Bipolar Disorder BEFREE 21440632
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bipolar Disorder Bipolar Disorder PSYGENET_DG 21440632
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cutaneous Melanoma Melanoma BEFREE 29864111
★☆☆☆☆
Found in Text Mining only
Cystic Fibrosis Cystic Fibrosis BEFREE 25763772
★☆☆☆☆
Found in Text Mining only
melanoma Melanoma BEFREE 29864111
★☆☆☆☆
Found in Text Mining only
Melanoma Cutaneous Malignant Melanoma Pubtator 29864111 Associate
★☆☆☆☆
Found in Text Mining only
Respiration Disorders Respiration Disorders BEFREE 25763772
★☆☆☆☆
Found in Text Mining only
Respiratory Tract Diseases Respiratory Tract Diseases BEFREE 25763772
★☆☆☆☆
Found in Text Mining only