Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8451
Gene name	Cullin 4A
Gene symbol	CUL4A
Synonyms (NCBI Gene)	-
Chromosome	13
Chromosome location	13q34
Summary	CUL4A is the ubiquitin ligase component of a multimeric complex involved in the degradation of DNA damage-response proteins (Liu et al., 2009 [PubMed 19481525]).[supplied by OMIM, Oct 2009]

368

Show/Hide all (368)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027107	hsa-miR-103a-3p	Sequencing	20371350
MIRT031821	hsa-miR-16-5p	Proteomics	18668040
MIRT050685	hsa-miR-18a-5p	CLASH	23622248
MIRT048313	hsa-miR-106a-5p	CLASH	23622248
MIRT046251	hsa-miR-23b-3p	CLASH	23622248
MIRT041473	hsa-miR-193b-3p	CLASH	23622248
MIRT039946	hsa-miR-615-3p	CLASH	23622248
MIRT723458	hsa-miR-4432	HITS-CLIP	19536157
MIRT723457	hsa-miR-451b	HITS-CLIP	19536157
MIRT723456	hsa-miR-4453	HITS-CLIP	19536157
MIRT723455	hsa-miR-4538	HITS-CLIP	19536157
MIRT248955	hsa-miR-6501-3p	HITS-CLIP	19536157
MIRT723454	hsa-miR-635	HITS-CLIP	19536157
MIRT723453	hsa-miR-6774-5p	HITS-CLIP	19536157
MIRT723452	hsa-miR-4696	HITS-CLIP	19536157
MIRT723451	hsa-miR-196a-3p	HITS-CLIP	19536157
MIRT731304	hsa-miR-9-5p	Luciferase reporter assay	26840256
MIRT731304	hsa-miR-9-5p	Luciferase reporter assay	26840256
MIRT731305	hsa-miR-137	Luciferase reporter assay	26840256
MIRT731305	hsa-miR-137	Luciferase reporter assay	26840256
MIRT731304	hsa-miR-9-5p	ImmunofluorescenceImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	26840256
MIRT731304	hsa-miR-9-5p	ImmunofluorescenceImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	26840256
MIRT731305	hsa-miR-137	ImmunofluorescenceImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	26840256
MIRT731305	hsa-miR-137	ImmunofluorescenceImmunohistochemistryImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	26840256
MIRT723458	hsa-miR-4432	HITS-CLIP	19536157
MIRT723457	hsa-miR-451b	HITS-CLIP	19536157
MIRT723456	hsa-miR-4453	HITS-CLIP	19536157
MIRT723455	hsa-miR-4538	HITS-CLIP	19536157
MIRT248955	hsa-miR-6501-3p	HITS-CLIP	19536157
MIRT723454	hsa-miR-635	HITS-CLIP	19536157
MIRT723453	hsa-miR-6774-5p	HITS-CLIP	19536157
MIRT723452	hsa-miR-4696	HITS-CLIP	19536157
MIRT723451	hsa-miR-196a-3p	HITS-CLIP	19536157
MIRT755340	hsa-miR-665	Luciferase reporter assayqRT-PCRRNA pull down assay	37507642
MIRT755340	hsa-miR-665	Luciferase reporter assayqRT-PCRFlow cytometryELISARNA pull down assay	37507642
MIRT916567	hsa-miR-103a	CLIP-seq
MIRT916568	hsa-miR-107	CLIP-seq
MIRT916569	hsa-miR-1182	CLIP-seq
MIRT916570	hsa-miR-1266	CLIP-seq
MIRT916571	hsa-miR-1271	CLIP-seq
MIRT916572	hsa-miR-181a	CLIP-seq
MIRT916573	hsa-miR-181b	CLIP-seq
MIRT916574	hsa-miR-181c	CLIP-seq
MIRT916575	hsa-miR-181d	CLIP-seq
MIRT916576	hsa-miR-193a-5p	CLIP-seq
MIRT916577	hsa-miR-216a	CLIP-seq
MIRT916578	hsa-miR-25	CLIP-seq
MIRT916579	hsa-miR-3127-5p	CLIP-seq
MIRT916580	hsa-miR-3179	CLIP-seq
MIRT916581	hsa-miR-3194-3p	CLIP-seq
MIRT916582	hsa-miR-32	CLIP-seq
MIRT916583	hsa-miR-3200-5p	CLIP-seq
MIRT916584	hsa-miR-363	CLIP-seq
MIRT916585	hsa-miR-367	CLIP-seq
MIRT916586	hsa-miR-3670	CLIP-seq
MIRT916587	hsa-miR-371-5p	CLIP-seq
MIRT916588	hsa-miR-371b-5p	CLIP-seq
MIRT916589	hsa-miR-377	CLIP-seq
MIRT916590	hsa-miR-3921	CLIP-seq
MIRT916591	hsa-miR-3973	CLIP-seq
MIRT916592	hsa-miR-4255	CLIP-seq
MIRT916593	hsa-miR-4262	CLIP-seq
MIRT916594	hsa-miR-4270	CLIP-seq
MIRT916595	hsa-miR-4300	CLIP-seq
MIRT916596	hsa-miR-4303	CLIP-seq
MIRT916597	hsa-miR-433	CLIP-seq
MIRT916598	hsa-miR-4441	CLIP-seq
MIRT916599	hsa-miR-450b-5p	CLIP-seq
MIRT916600	hsa-miR-4518	CLIP-seq
MIRT916601	hsa-miR-4521	CLIP-seq
MIRT916602	hsa-miR-4639-3p	CLIP-seq
MIRT916603	hsa-miR-4649-3p	CLIP-seq
MIRT916604	hsa-miR-4653-5p	CLIP-seq
MIRT916605	hsa-miR-4705	CLIP-seq
MIRT916606	hsa-miR-4719	CLIP-seq
MIRT916607	hsa-miR-4728-3p	CLIP-seq
MIRT916608	hsa-miR-4795-3p	CLIP-seq
MIRT916609	hsa-miR-4797-5p	CLIP-seq
MIRT916610	hsa-miR-4799-5p	CLIP-seq
MIRT916611	hsa-miR-507	CLIP-seq
MIRT916612	hsa-miR-5096	CLIP-seq
MIRT916613	hsa-miR-520g	CLIP-seq
MIRT916614	hsa-miR-520h	CLIP-seq
MIRT916615	hsa-miR-557	CLIP-seq
MIRT916616	hsa-miR-610	CLIP-seq
MIRT916617	hsa-miR-626	CLIP-seq
MIRT916618	hsa-miR-802	CLIP-seq
MIRT916619	hsa-miR-920	CLIP-seq
MIRT916620	hsa-miR-92a	CLIP-seq
MIRT916621	hsa-miR-92b	CLIP-seq
MIRT916622	hsa-miR-96	CLIP-seq
MIRT916623	hsa-miR-1251	CLIP-seq
MIRT916624	hsa-miR-216b	CLIP-seq
MIRT916625	hsa-miR-3613-3p	CLIP-seq
MIRT916626	hsa-miR-3675-3p	CLIP-seq
MIRT916627	hsa-miR-3688-3p	CLIP-seq
MIRT916628	hsa-miR-4261	CLIP-seq
MIRT916629	hsa-miR-4305	CLIP-seq
MIRT916630	hsa-miR-4311	CLIP-seq
MIRT916631	hsa-miR-4633-5p	CLIP-seq
MIRT916632	hsa-miR-4659a-5p	CLIP-seq
MIRT916633	hsa-miR-4659b-5p	CLIP-seq
MIRT916634	hsa-miR-4704-5p	CLIP-seq
MIRT916635	hsa-miR-603	CLIP-seq
MIRT916636	hsa-miR-607	CLIP-seq
MIRT1971868	hsa-miR-1208	CLIP-seq
MIRT1971869	hsa-miR-1288	CLIP-seq
MIRT916572	hsa-miR-181a	CLIP-seq
MIRT916573	hsa-miR-181b	CLIP-seq
MIRT916574	hsa-miR-181c	CLIP-seq
MIRT916575	hsa-miR-181d	CLIP-seq
MIRT1971870	hsa-miR-2115	CLIP-seq
MIRT1971871	hsa-miR-218	CLIP-seq
MIRT1971872	hsa-miR-3074-5p	CLIP-seq
MIRT1971873	hsa-miR-3124-3p	CLIP-seq
MIRT1971874	hsa-miR-3184	CLIP-seq
MIRT916581	hsa-miR-3194-3p	CLIP-seq
MIRT1971875	hsa-miR-3199	CLIP-seq
MIRT1971876	hsa-miR-370	CLIP-seq
MIRT916589	hsa-miR-377	CLIP-seq
MIRT916590	hsa-miR-3921	CLIP-seq
MIRT1971877	hsa-miR-3934	CLIP-seq
MIRT1971878	hsa-miR-3978	CLIP-seq
MIRT1971879	hsa-miR-423-5p	CLIP-seq
MIRT916593	hsa-miR-4262	CLIP-seq
MIRT1971880	hsa-miR-4289	CLIP-seq
MIRT1971881	hsa-miR-4420	CLIP-seq
MIRT916603	hsa-miR-4649-3p	CLIP-seq
MIRT916604	hsa-miR-4653-5p	CLIP-seq
MIRT1971882	hsa-miR-4668-3p	CLIP-seq
MIRT1971883	hsa-miR-4714-3p	CLIP-seq
MIRT1971884	hsa-miR-4724-5p	CLIP-seq
MIRT1971885	hsa-miR-4731-3p	CLIP-seq
MIRT1971886	hsa-miR-4789-5p	CLIP-seq
MIRT1971887	hsa-miR-4801	CLIP-seq
MIRT1971888	hsa-miR-494	CLIP-seq
MIRT1971889	hsa-miR-500a	CLIP-seq
MIRT1971890	hsa-miR-501-5p	CLIP-seq
MIRT1971891	hsa-miR-513b	CLIP-seq
MIRT1971892	hsa-miR-516a-3p	CLIP-seq
MIRT1971893	hsa-miR-548aa	CLIP-seq
MIRT1971894	hsa-miR-552	CLIP-seq
MIRT1971895	hsa-miR-636	CLIP-seq
MIRT916567	hsa-miR-103a	CLIP-seq
MIRT916568	hsa-miR-107	CLIP-seq
MIRT916569	hsa-miR-1182	CLIP-seq
MIRT2207515	hsa-miR-1207-3p	CLIP-seq
MIRT1971868	hsa-miR-1208	CLIP-seq
MIRT2207516	hsa-miR-1264	CLIP-seq
MIRT2207517	hsa-miR-1301	CLIP-seq
MIRT916572	hsa-miR-181a	CLIP-seq
MIRT916573	hsa-miR-181b	CLIP-seq
MIRT916574	hsa-miR-181c	CLIP-seq
MIRT916575	hsa-miR-181d	CLIP-seq
MIRT916576	hsa-miR-193a-5p	CLIP-seq
MIRT2207518	hsa-miR-200b	CLIP-seq
MIRT2207519	hsa-miR-200c	CLIP-seq
MIRT1971870	hsa-miR-2115	CLIP-seq
MIRT2207520	hsa-miR-214	CLIP-seq
MIRT916577	hsa-miR-216a	CLIP-seq
MIRT1971871	hsa-miR-218	CLIP-seq
MIRT916578	hsa-miR-25	CLIP-seq
MIRT2207521	hsa-miR-3065-5p	CLIP-seq
MIRT1971872	hsa-miR-3074-5p	CLIP-seq
MIRT2207522	hsa-miR-3120-3p	CLIP-seq
MIRT2207523	hsa-miR-3141	CLIP-seq
MIRT916581	hsa-miR-3194-3p	CLIP-seq
MIRT916582	hsa-miR-32	CLIP-seq
MIRT2207524	hsa-miR-34c-3p	CLIP-seq
MIRT2207525	hsa-miR-3619-5p	CLIP-seq
MIRT916584	hsa-miR-363	CLIP-seq
MIRT2207526	hsa-miR-3655	CLIP-seq
MIRT916585	hsa-miR-367	CLIP-seq
MIRT1971876	hsa-miR-370	CLIP-seq
MIRT916587	hsa-miR-371-5p	CLIP-seq
MIRT916588	hsa-miR-371b-5p	CLIP-seq
MIRT916589	hsa-miR-377	CLIP-seq
MIRT2207527	hsa-miR-3919	CLIP-seq
MIRT916590	hsa-miR-3921	CLIP-seq
MIRT2207528	hsa-miR-3925-5p	CLIP-seq
MIRT1971877	hsa-miR-3934	CLIP-seq
MIRT916591	hsa-miR-3973	CLIP-seq
MIRT916593	hsa-miR-4262	CLIP-seq
MIRT916594	hsa-miR-4270	CLIP-seq
MIRT1971880	hsa-miR-4289	CLIP-seq
MIRT2207529	hsa-miR-429	CLIP-seq
MIRT916597	hsa-miR-433	CLIP-seq
MIRT1971881	hsa-miR-4420	CLIP-seq
MIRT916598	hsa-miR-4441	CLIP-seq
MIRT916601	hsa-miR-4521	CLIP-seq
MIRT2207530	hsa-miR-4539	CLIP-seq
MIRT916603	hsa-miR-4649-3p	CLIP-seq
MIRT916604	hsa-miR-4653-5p	CLIP-seq
MIRT2207531	hsa-miR-4660	CLIP-seq
MIRT1971882	hsa-miR-4668-3p	CLIP-seq
MIRT2207532	hsa-miR-4698	CLIP-seq
MIRT916605	hsa-miR-4705	CLIP-seq
MIRT1971883	hsa-miR-4714-3p	CLIP-seq
MIRT916606	hsa-miR-4719	CLIP-seq
MIRT1971884	hsa-miR-4724-5p	CLIP-seq
MIRT1971885	hsa-miR-4731-3p	CLIP-seq
MIRT2207533	hsa-miR-4753-3p	CLIP-seq
MIRT2207534	hsa-miR-4778-3p	CLIP-seq
MIRT1971886	hsa-miR-4789-5p	CLIP-seq
MIRT916608	hsa-miR-4795-3p	CLIP-seq
MIRT1971887	hsa-miR-4801	CLIP-seq
MIRT2207535	hsa-miR-495	CLIP-seq
MIRT2207536	hsa-miR-499-3p	CLIP-seq
MIRT2207537	hsa-miR-499a-3p	CLIP-seq
MIRT2207538	hsa-miR-5047	CLIP-seq
MIRT2207539	hsa-miR-512-5p	CLIP-seq
MIRT2207540	hsa-miR-514	CLIP-seq
MIRT2207541	hsa-miR-514b-3p	CLIP-seq
MIRT1971892	hsa-miR-516a-3p	CLIP-seq
MIRT916613	hsa-miR-520g	CLIP-seq
MIRT916614	hsa-miR-520h	CLIP-seq
MIRT1971893	hsa-miR-548aa	CLIP-seq
MIRT2207542	hsa-miR-548l	CLIP-seq
MIRT2207543	hsa-miR-548n	CLIP-seq
MIRT1971894	hsa-miR-552	CLIP-seq
MIRT2207544	hsa-miR-578	CLIP-seq
MIRT2207545	hsa-miR-582-5p	CLIP-seq
MIRT916616	hsa-miR-610	CLIP-seq
MIRT1971895	hsa-miR-636	CLIP-seq
MIRT2207546	hsa-miR-642b	CLIP-seq
MIRT2207547	hsa-miR-761	CLIP-seq
MIRT916618	hsa-miR-802	CLIP-seq
MIRT2207548	hsa-miR-922	CLIP-seq
MIRT916620	hsa-miR-92a	CLIP-seq
MIRT916621	hsa-miR-92b	CLIP-seq
MIRT2207549	hsa-miR-942	CLIP-seq
MIRT2510746	hsa-miR-1184	CLIP-seq
MIRT2510747	hsa-miR-1205	CLIP-seq
MIRT2207515	hsa-miR-1207-3p	CLIP-seq
MIRT2207516	hsa-miR-1264	CLIP-seq
MIRT2510748	hsa-miR-1287	CLIP-seq
MIRT2510749	hsa-miR-142-5p	CLIP-seq
MIRT916572	hsa-miR-181a	CLIP-seq
MIRT916573	hsa-miR-181b	CLIP-seq
MIRT916574	hsa-miR-181c	CLIP-seq
MIRT916575	hsa-miR-181d	CLIP-seq
MIRT1971870	hsa-miR-2115	CLIP-seq
MIRT2207520	hsa-miR-214	CLIP-seq
MIRT1971871	hsa-miR-218	CLIP-seq
MIRT1971872	hsa-miR-3074-5p	CLIP-seq
MIRT2510750	hsa-miR-3125	CLIP-seq
MIRT2510751	hsa-miR-3133	CLIP-seq
MIRT2207523	hsa-miR-3141	CLIP-seq
MIRT2510752	hsa-miR-3148	CLIP-seq
MIRT2510753	hsa-miR-3158-5p	CLIP-seq
MIRT916581	hsa-miR-3194-3p	CLIP-seq
MIRT2510754	hsa-miR-340	CLIP-seq
MIRT2510755	hsa-miR-3611	CLIP-seq
MIRT2510756	hsa-miR-3616-5p	CLIP-seq
MIRT2207525	hsa-miR-3619-5p	CLIP-seq
MIRT2510757	hsa-miR-3647-5p	CLIP-seq
MIRT2207526	hsa-miR-3655	CLIP-seq
MIRT2510758	hsa-miR-3665	CLIP-seq
MIRT2510759	hsa-miR-3667-3p	CLIP-seq
MIRT916627	hsa-miR-3688-3p	CLIP-seq
MIRT1971876	hsa-miR-370	CLIP-seq
MIRT2510760	hsa-miR-380	CLIP-seq
MIRT2510761	hsa-miR-3916	CLIP-seq
MIRT916590	hsa-miR-3921	CLIP-seq
MIRT2510762	hsa-miR-3924	CLIP-seq
MIRT1971877	hsa-miR-3934	CLIP-seq
MIRT2510763	hsa-miR-3943	CLIP-seq
MIRT916592	hsa-miR-4255	CLIP-seq
MIRT916628	hsa-miR-4261	CLIP-seq
MIRT916593	hsa-miR-4262	CLIP-seq
MIRT2510764	hsa-miR-4287	CLIP-seq
MIRT2510765	hsa-miR-4297	CLIP-seq
MIRT2510766	hsa-miR-4312	CLIP-seq
MIRT2510767	hsa-miR-4323	CLIP-seq
MIRT2510768	hsa-miR-4457	CLIP-seq
MIRT2510769	hsa-miR-4495	CLIP-seq
MIRT2510770	hsa-miR-4511	CLIP-seq
MIRT916603	hsa-miR-4649-3p	CLIP-seq
MIRT916604	hsa-miR-4653-5p	CLIP-seq
MIRT2510771	hsa-miR-4668-5p	CLIP-seq
MIRT2510772	hsa-miR-4685-3p	CLIP-seq
MIRT916634	hsa-miR-4704-5p	CLIP-seq
MIRT1971885	hsa-miR-4731-3p	CLIP-seq
MIRT2207533	hsa-miR-4753-3p	CLIP-seq
MIRT2510773	hsa-miR-4756-3p	CLIP-seq
MIRT2207534	hsa-miR-4778-3p	CLIP-seq
MIRT1971887	hsa-miR-4801	CLIP-seq
MIRT1971888	hsa-miR-494	CLIP-seq
MIRT2207539	hsa-miR-512-5p	CLIP-seq
MIRT1971891	hsa-miR-513b	CLIP-seq
MIRT1971892	hsa-miR-516a-3p	CLIP-seq
MIRT2510774	hsa-miR-526b	CLIP-seq
MIRT2510775	hsa-miR-548a-3p	CLIP-seq
MIRT2510776	hsa-miR-548a-5p	CLIP-seq
MIRT2510777	hsa-miR-548ab	CLIP-seq
MIRT2510778	hsa-miR-548ae	CLIP-seq
MIRT2510779	hsa-miR-548aj	CLIP-seq
MIRT2510780	hsa-miR-548ak	CLIP-seq
MIRT2510781	hsa-miR-548am	CLIP-seq
MIRT2510782	hsa-miR-548b-5p	CLIP-seq
MIRT2510783	hsa-miR-548c-5p	CLIP-seq
MIRT2510784	hsa-miR-548d-5p	CLIP-seq
MIRT2510785	hsa-miR-548e	CLIP-seq
MIRT2510786	hsa-miR-548f	CLIP-seq
MIRT2510787	hsa-miR-548h	CLIP-seq
MIRT2510788	hsa-miR-548i	CLIP-seq
MIRT2510789	hsa-miR-548j	CLIP-seq
MIRT2510790	hsa-miR-548k	CLIP-seq
MIRT2207542	hsa-miR-548l	CLIP-seq
MIRT2510791	hsa-miR-548w	CLIP-seq
MIRT2510792	hsa-miR-548x	CLIP-seq
MIRT2510793	hsa-miR-548y	CLIP-seq
MIRT1971894	hsa-miR-552	CLIP-seq
MIRT2510794	hsa-miR-559	CLIP-seq
MIRT2510795	hsa-miR-573	CLIP-seq
MIRT2207544	hsa-miR-578	CLIP-seq
MIRT916635	hsa-miR-603	CLIP-seq
MIRT1971895	hsa-miR-636	CLIP-seq
MIRT2207546	hsa-miR-642b	CLIP-seq
MIRT2510796	hsa-miR-657	CLIP-seq
MIRT755340	hsa-miR-665	CLIP-seq
MIRT2207547	hsa-miR-761	CLIP-seq
MIRT916618	hsa-miR-802	CLIP-seq
MIRT2510797	hsa-miR-877	CLIP-seq
MIRT2207549	hsa-miR-942	CLIP-seq
MIRT2510746	hsa-miR-1184	CLIP-seq
MIRT2510747	hsa-miR-1205	CLIP-seq
MIRT2207515	hsa-miR-1207-3p	CLIP-seq
MIRT2207516	hsa-miR-1264	CLIP-seq
MIRT2207520	hsa-miR-214	CLIP-seq
MIRT2510750	hsa-miR-3125	CLIP-seq
MIRT2510751	hsa-miR-3133	CLIP-seq
MIRT2207523	hsa-miR-3141	CLIP-seq
MIRT2510752	hsa-miR-3148	CLIP-seq
MIRT2510753	hsa-miR-3158-5p	CLIP-seq
MIRT2510756	hsa-miR-3616-5p	CLIP-seq
MIRT2207525	hsa-miR-3619-5p	CLIP-seq
MIRT2510757	hsa-miR-3647-5p	CLIP-seq
MIRT2510758	hsa-miR-3665	CLIP-seq
MIRT916627	hsa-miR-3688-3p	CLIP-seq
MIRT2510761	hsa-miR-3916	CLIP-seq
MIRT2510763	hsa-miR-3943	CLIP-seq
MIRT916628	hsa-miR-4261	CLIP-seq
MIRT2510767	hsa-miR-4323	CLIP-seq
MIRT2510768	hsa-miR-4457	CLIP-seq
MIRT2510770	hsa-miR-4511	CLIP-seq
MIRT2510771	hsa-miR-4668-5p	CLIP-seq
MIRT916634	hsa-miR-4704-5p	CLIP-seq
MIRT1971885	hsa-miR-4731-3p	CLIP-seq
MIRT2207533	hsa-miR-4753-3p	CLIP-seq
MIRT2510773	hsa-miR-4756-3p	CLIP-seq
MIRT1971887	hsa-miR-4801	CLIP-seq
MIRT2207539	hsa-miR-512-5p	CLIP-seq
MIRT1971891	hsa-miR-513b	CLIP-seq
MIRT2510775	hsa-miR-548a-3p	CLIP-seq
MIRT2510778	hsa-miR-548ae	CLIP-seq
MIRT2510779	hsa-miR-548aj	CLIP-seq
MIRT2510781	hsa-miR-548am	CLIP-seq
MIRT2510785	hsa-miR-548e	CLIP-seq
MIRT2510786	hsa-miR-548f	CLIP-seq
MIRT2510792	hsa-miR-548x	CLIP-seq
MIRT2510795	hsa-miR-573	CLIP-seq
MIRT916635	hsa-miR-603	CLIP-seq
MIRT2207546	hsa-miR-642b	CLIP-seq
MIRT2510796	hsa-miR-657	CLIP-seq
MIRT2207547	hsa-miR-761	CLIP-seq
MIRT2510797	hsa-miR-877	CLIP-seq
MIRT2207549	hsa-miR-942	CLIP-seq

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	8681378
GO:0001701	Process	In utero embryonic development	IEA
GO:0005515	Function	Protein binding	IPI	12504025, 12504026, 12609982, 14739464, 16473935, 16949367, 16964240, 17041588, 18775313, 19966799, 21113133, 21145461, 21778237, 22157821, 22466964, 22939624, 26496610, 26906416, 28514442, 30945288, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IC	22118460
GO:0005634	Component	Nucleus	IDA	10585395, 11027288
GO:0005634	Component	Nucleus	NAS	22118460
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34065512
GO:0006281	Process	DNA repair	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006974	Process	DNA damage response	EXP	22118460
GO:0006974	Process	DNA damage response	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0007283	Process	Spermatogenesis	IDA	34065512
GO:0007283	Process	Spermatogenesis	IDA	34065512
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IDA	26431207
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	IMP	28437394
GO:0030097	Process	Hemopoiesis	IEA
GO:0030853	Process	Negative regulation of granulocyte differentiation	IEA
GO:0031461	Component	Cullin-RING ubiquitin ligase complex	IEA
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	EXP	22118460
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IBA
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IDA	12732143, 14739464, 17085480, 18794347, 20129063, 20223979
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	11027288, 20870715
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032502	Process	Developmental process	IEA
GO:0034644	Process	Cellular response to UV	EXP	22118460
GO:0034644	Process	Cellular response to UV	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035279	Process	MiRNA-mediated gene silencing by mRNA destabilization	IDA	16289642
GO:0042110	Process	T cell activation	IDA	34065512
GO:0042110	Process	T cell activation	IDA	34065512
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042254	Process	Ribosome biogenesis	IMP	26711351
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	14739464
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	11027288, 16482215, 27626656
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	11027288, 20870715
GO:0048511	Process	Rhythmic process	IEA
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	23391734
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	20870715
GO:0080008	Component	Cul4-RING E3 ubiquitin ligase complex	IDA	16949367, 18381890, 32355176, 34526721
GO:0097193	Process	Intrinsic apoptotic signaling pathway	TAS	8681378
GO:0097510	Process	Base-excision repair, AP site formation via deaminated base removal	IDA	18973764
GO:0140627	Process	Ubiquitin-dependent protein catabolic process via the C-end degron rule pathway	IDA	29779948, 31267705, 34065512
GO:0140627	Process	Ubiquitin-dependent protein catabolic process via the C-end degron rule pathway	IDA	34065512
GO:0160072	Function	Ubiquitin ligase complex scaffold activity	IDA	34065512
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IEA
GO:2000001	Process	Regulation of DNA damage checkpoint	IEA
GO:2000819	Process	Regulation of nucleotide-excision repair	IEA

MIM	HGNC	e!Ensembl
603137	2554	ENSG00000139842

Q13619

Protein name

Cullin-4A (CUL-4A)

Protein function

Core component of multiple cullin-RING-based E3 ubiquitin-protein ligase complexes which mediate the ubiquitination of target proteins (PubMed:14578910, PubMed:14739464, PubMed:15448697, PubMed:15548678, PubMed:15811626, PubMed:16678110, PubMed:

PDB

2HYE , 4A0K , 7OKQ , 7OPC , 7OPD , 8B3G , 8B3I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00888	Cullin	63 → 660	Cullin family	Family
PF10557	Cullin_Nedd8	691 → 751	Cullin protein neddylation domain	Domain

Sequence

MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQ
DTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILP
FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRT
HIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETN
CLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKD
MVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPME
VHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLL
MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA

Sequence length

759

Interactions

View interactions

	KEGG		Reactome
	Nucleotide excision repair Ubiquitin mediated proteolysis Human immunodeficiency virus 1 infection		Recognition of DNA damage by PCNA-containing replication complex DNA Damage Recognition in GG-NER Formation of Incision Complex in GG-NER Dual Incision in GG-NER Formation of TC-NER Pre-Incision Complex Transcription-Coupled Nucleotide Excision Repair (TC-NER) Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER Neddylation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (78)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	22120631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	30355689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	31101894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12077329, 19995430, 23364677, 24368600, 24870930, 28902348, 31374029, 9721878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10585395, 28902348	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19995430, 24368600, 31374029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23845142, 27974468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27461685, 30015884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24648314, 25413624, 26503734, 27974468, 28236704, 31052599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	38423594	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27983981, 29512715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26684807, 28576144, 34257560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31060565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26965998, 30562757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28095394, 28223829, 30092404, 30562757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28095394, 34720086, 36312839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30945295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33179082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31535245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31535245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	38101299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37092838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30945295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28576144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12029633, 26593394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12029633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12878869, 27974468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24648314, 25413624, 31052599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25413624	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38423594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12077329, 19995430, 23364677, 23845142, 24368600, 24870930, 28902348, 31374029, 9721878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31535245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19430492, 30015884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24648314, 25413624, 26503734, 27974468, 28236704, 31052599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27983981, 29512715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22422151, 26036759, 28212551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	23845142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26840256, 30864186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23845142, 25413624, 26055549, 26840256, 27974468, 28223829, 28336923, 28677427, 29512715, 31535245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26965998, 30562757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24870930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	19929949, 26218750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	19929949	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	26218750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19929949	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26218750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26823144, 28677427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28677427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycoplasma-Induced Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31860954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	34257560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19929949, 19995430, 21205828, 22422151, 24420924, 24648314, 25413624, 26218750, 26503734, 26593394, 26715273, 26965998, 27974468, 28223829, 28428711, 29190892, 30562757 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24082123, 25413624, 30720173, 31052599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26055549, 26715273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26715273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27983981, 29512715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29512715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	38423594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	22120631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	23845142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22422151, 26036759, 28212551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26036759, 28212551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31060565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	23364677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31535245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37695034	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26840256, 30864186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32116109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33155196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	23845142		★★★★★ ★☆☆☆☆ Found in Text Mining only

CUL4A (cullin 4A)