Gene Gene information from NCBI Gene database.
Entrez ID 84504
Gene name NK6 homeobox 2
Gene symbol NKX6-2
Synonyms (NCBI Gene)
GTXNKX6.2NKX6BSPAX8
Chromosome 10
Chromosome location 10q26.3
SNPs SNP information provided by dbSNP.
9
SNP ID Visualize variation Clinical significance Consequence
rs765650727 C>-,CC Likely-pathogenic Coding sequence variant, frameshift variant
rs776560015 C>A,G,T Pathogenic Coding sequence variant, missense variant, stop gained
rs1008088032 C>G,T Pathogenic Missense variant, coding sequence variant
rs1131692047 T>A Pathogenic Stop gained, coding sequence variant
rs1131692048 G>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
129
miRTarBase ID miRNA Experiments Reference
MIRT488417 hsa-miR-6784-5p PAR-CLIP 20371350
MIRT488416 hsa-miR-6777-5p PAR-CLIP 20371350
MIRT488415 hsa-miR-6889-5p PAR-CLIP 20371350
MIRT488414 hsa-miR-3184-5p PAR-CLIP 20371350
MIRT488413 hsa-miR-423-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605955 19321 ENSG00000148826
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9C056
Protein name Homeobox protein Nkx-6.2 (Homeobox protein NK-6 homolog B)
Protein function Transcription factor with repressor activity involved in the regulation of axon-glial interactions at myelin paranodes in oligodendrocytes. Binds to the consensus DNA sequence 5'-(A/T)TTAATGA-3'. In oligodendrocytes, binds to MBP and PLP1 promot
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 149 205 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Highest expression in brain. {ECO:0000269|PubMed:11210186}.
Sequence
MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGI
SDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPG
VVQGAPWRDPRLAGPAPAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERAR
LAYSLGMTESQVKVWFQNRRTKWRK
RHAVEMASAKKKQDSDAEKLKVGGSDAEDDDEYNR
PLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDAL
Sequence length 277
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Spastic ataxia 8, autosomal recessive, with hypomyelinating leukodystrophy Likely pathogenic; Pathogenic rs765650727, rs2134707158, rs1207105923, rs2134706311, rs2134706153, rs770310729, rs2134706418, rs2493481426, rs1131692047, rs1131692048, rs1554961118, rs1565019928, rs1565019932, rs1008088032, rs1565019976
View all (1 more)
RCV004796644
RCV001784750
RCV001849691
RCV001849693
RCV001849694
View all (12 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
NKX6-2-related disorder Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of pancreas Pancreatic adenocarcinoma BEFREE 29212734
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 21586619
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 11210186
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 21586619
★☆☆☆☆
Found in Text Mining only
Cerebellar atrophy Cerebellar atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebral atrophy Cerebral Atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Chronic Kidney Diseases Kidney Disease BEFREE 26317775
★☆☆☆☆
Found in Text Mining only
Clumsiness - motor delay Motor delay HPO_DG
★☆☆☆☆
Found in Text Mining only
Dysarthria Dysarthria HPO_DG
★☆☆☆☆
Found in Text Mining only
Epilepsy Epilepsy BEFREE 31509304
★☆☆☆☆
Found in Text Mining only