Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84466
Gene name	Multiple EGF like domains 10
Gene symbol	MEGF10
Synonyms (NCBI Gene)	CMYO10ACMYO10BCMYP10ACMYP10BEMARDDSR-F3
Chromosome	5
Chromosome location	5q23.2
Summary	This gene encodes a member of the multiple epidermal growth factor-like domains protein family. The encoded protein plays a role in cell adhesion, motility and proliferation, and is a critical mediator of apoptotic cell phagocytosis as well as amyloid-bet

Show/Hide all (25)

SNP ID	Visualize variation	Clinical significance	Consequence
rs35591368	C>G,T	Conflicting-interpretations-of-pathogenicity, benign	Coding sequence variant, synonymous variant, genic downstream transcript variant, missense variant
rs115184652	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Intron variant
rs199750143	A>C,G	Conflicting-interpretations-of-pathogenicity	Splice acceptor variant, genic downstream transcript variant
rs200174116	G>A,T	Likely-pathogenic	Missense variant, coding sequence variant, stop gained
rs372378202	T>C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Intron variant, genic downstream transcript variant
rs387907071	C>A,T	Pathogenic	Genic downstream transcript variant, coding sequence variant, synonymous variant, stop gained
rs387907072	T>C	Pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs387907073	T>C	Pathogenic	Coding sequence variant, missense variant, 5 prime UTR variant
rs387907074	C>T	Pathogenic	Genic upstream transcript variant, coding sequence variant, missense variant
rs762560221	->T	Likely-pathogenic	Splice donor variant, genic downstream transcript variant
rs794726677	G>A	Pathogenic	Coding sequence variant, stop gained
rs794726678	T>G	Pathogenic	Coding sequence variant, genic downstream transcript variant, stop gained
rs794726679	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs931073338	G>A,C	Likely-pathogenic	Genic upstream transcript variant, splice donor variant
rs989552169	C>T	Pathogenic	Genic downstream transcript variant, stop gained, coding sequence variant
rs1057518682	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1057519152	G>A	Likely-pathogenic	Genic downstream transcript variant, splice acceptor variant
rs1057523896	G>A	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs1064793831	G>T	Pathogenic	Stop gained, coding sequence variant, genic upstream transcript variant
rs1064795948	G>-	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant
rs1291487750	->A	Likely-pathogenic	Coding sequence variant, genic upstream transcript variant, frameshift variant
rs1298663120	G>A	Likely-pathogenic	Genic downstream transcript variant, splice donor variant
rs1454219963	C>T	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, stop gained
rs1561599823	T>C	Likely-pathogenic	Splice donor variant, genic upstream transcript variant
rs1580733016	G>ACATTC	Pathogenic	Stop gained, coding sequence variant, genic upstream transcript variant

Show/Hide all (67)

miRTarBase ID	miRNA	Experiments
MIRT1142411	hsa-miR-1197	CLIP-seq
MIRT1142412	hsa-miR-1246	CLIP-seq
MIRT1142413	hsa-miR-1260	CLIP-seq
MIRT1142414	hsa-miR-1260b	CLIP-seq
MIRT1142415	hsa-miR-1290	CLIP-seq
MIRT1142416	hsa-miR-188-3p	CLIP-seq
MIRT1142417	hsa-miR-3120-3p	CLIP-seq
MIRT1142418	hsa-miR-3134	CLIP-seq
MIRT1142419	hsa-miR-3150a-5p	CLIP-seq
MIRT1142420	hsa-miR-3150b-5p	CLIP-seq
MIRT1142421	hsa-miR-3156-3p	CLIP-seq
MIRT1142422	hsa-miR-3167	CLIP-seq
MIRT1142423	hsa-miR-3671	CLIP-seq
MIRT1142424	hsa-miR-4276	CLIP-seq
MIRT1142425	hsa-miR-4301	CLIP-seq
MIRT1142426	hsa-miR-433	CLIP-seq
MIRT1142427	hsa-miR-4528	CLIP-seq
MIRT1142428	hsa-miR-4534	CLIP-seq
MIRT1142429	hsa-miR-4728-3p	CLIP-seq
MIRT1142430	hsa-miR-4753-3p	CLIP-seq
MIRT1142431	hsa-miR-4768-5p	CLIP-seq
MIRT1142432	hsa-miR-4803	CLIP-seq
MIRT1142433	hsa-miR-487a	CLIP-seq
MIRT1142434	hsa-miR-548p	CLIP-seq
MIRT1142435	hsa-miR-659	CLIP-seq
MIRT1142436	hsa-miR-876-5p	CLIP-seq
MIRT1142417	hsa-miR-3120-3p	CLIP-seq
MIRT2040442	hsa-miR-3622a-3p	CLIP-seq
MIRT2040443	hsa-miR-3622b-3p	CLIP-seq
MIRT2040444	hsa-miR-3658	CLIP-seq
MIRT2040445	hsa-miR-4326	CLIP-seq
MIRT2270202	hsa-miR-1200	CLIP-seq
MIRT2270203	hsa-miR-299-5p	CLIP-seq
MIRT2270204	hsa-miR-3074-5p	CLIP-seq
MIRT2270205	hsa-miR-3127-3p	CLIP-seq
MIRT2270206	hsa-miR-3140-5p	CLIP-seq
MIRT2270207	hsa-miR-33a	CLIP-seq
MIRT2270208	hsa-miR-33b	CLIP-seq
MIRT2040442	hsa-miR-3622a-3p	CLIP-seq
MIRT2040443	hsa-miR-3622b-3p	CLIP-seq
MIRT2270209	hsa-miR-4287	CLIP-seq
MIRT2270210	hsa-miR-4292	CLIP-seq
MIRT2270211	hsa-miR-4308	CLIP-seq
MIRT2270212	hsa-miR-4330	CLIP-seq
MIRT2270213	hsa-miR-4469	CLIP-seq
MIRT2270214	hsa-miR-4685-3p	CLIP-seq
MIRT2270215	hsa-miR-4713-5p	CLIP-seq
MIRT2270216	hsa-miR-584	CLIP-seq
MIRT1142417	hsa-miR-3120-3p	CLIP-seq
MIRT2453950	hsa-miR-1185	CLIP-seq
MIRT2453951	hsa-miR-1224-5p	CLIP-seq
MIRT2453952	hsa-miR-2392	CLIP-seq
MIRT2453953	hsa-miR-23a	CLIP-seq
MIRT2453954	hsa-miR-23b	CLIP-seq
MIRT2453955	hsa-miR-23c	CLIP-seq
MIRT2453956	hsa-miR-3605-5p	CLIP-seq
MIRT2453957	hsa-miR-3679-5p	CLIP-seq
MIRT2453958	hsa-miR-3688-5p	CLIP-seq
MIRT2453959	hsa-miR-3915	CLIP-seq
MIRT2453960	hsa-miR-4470	CLIP-seq
MIRT2453961	hsa-miR-4680-5p	CLIP-seq
MIRT2453962	hsa-miR-4689	CLIP-seq
MIRT2453963	hsa-miR-4717-3p	CLIP-seq
MIRT2453964	hsa-miR-4796-3p	CLIP-seq
MIRT2453965	hsa-miR-618	CLIP-seq
MIRT2453961	hsa-miR-4680-5p	CLIP-seq
MIRT2453965	hsa-miR-618	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001849	Function	Complement component C1q complex binding	IDA	27170117
GO:0001891	Component	Phagocytic cup	IDA	17205124
GO:0001891	Component	Phagocytic cup	IEA
GO:0005044	Function	Scavenger receptor activity	IDA	27170117
GO:0005112	Function	Notch binding	IBA
GO:0005112	Function	Notch binding	IEA
GO:0005112	Function	Notch binding	IPI	28498977
GO:0005886	Component	Plasma membrane	IDA	27170117
GO:0005886	Component	Plasma membrane	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007517	Process	Muscle organ development	IEA
GO:0014719	Process	Skeletal muscle satellite cell activation	IEA
GO:0014719	Process	Skeletal muscle satellite cell activation	ISS
GO:0014816	Process	Skeletal muscle satellite cell differentiation	IEA
GO:0014816	Process	Skeletal muscle satellite cell differentiation	IMP	22101682
GO:0014841	Process	Skeletal muscle satellite cell proliferation	IEA
GO:0014841	Process	Skeletal muscle satellite cell proliferation	ISS
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IMP	31267131
GO:0033002	Process	Muscle cell proliferation	IEA
GO:0033002	Process	Muscle cell proliferation	IMP	28498977
GO:0034109	Process	Homotypic cell-cell adhesion	IDA	22407321
GO:0042995	Component	Cell projection	IEA
GO:0043277	Process	Apoptotic cell clearance	IBA
GO:0043652	Process	Engulfment of apoptotic cell	IEA
GO:0043652	Process	Engulfment of apoptotic cell	ISS
GO:0043654	Process	Recognition of apoptotic cell	IEA
GO:0048468	Process	Cell development	IEA
GO:0048627	Process	Myoblast development	IEA
GO:0048641	Process	Regulation of skeletal muscle tissue development	IMP	22101682
GO:0051147	Process	Regulation of muscle cell differentiation	IMP	22101682
GO:0051451	Process	Myoblast migration	IEA
GO:0051451	Process	Myoblast migration	IMP	28498977
GO:0055001	Process	Muscle cell development	IMP	22101682
GO:1902742	Process	Apoptotic process involved in development	IEA
GO:1902742	Process	Apoptotic process involved in development	ISS
GO:2000288	Process	Positive regulation of myoblast proliferation	IEA
GO:2000288	Process	Positive regulation of myoblast proliferation	IMP	31267131

MIM	HGNC	e!Ensembl
612453	29634	ENSG00000145794

Q96KG7

Protein name

Multiple epidermal growth factor-like domains protein 10 (Multiple EGF-like domains protein 10)

Protein function

Membrane receptor involved in phagocytosis by macrophages and astrocytes of apoptotic cells. Receptor for C1q, an eat-me signal, that binds phosphatidylserine expressed on the surface of apoptotic cells (PubMed:27170117). Cooperates with ABCA1 w

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12661	hEGF	197 → 216	Human growth factor-like EGF	Domain
PF12661	hEGF	240 → 259	Human growth factor-like EGF	Domain
PF00053	Laminin_EGF	281 → 326	Laminin EGF domain	Domain
PF00053	Laminin_EGF	367 → 415	Laminin EGF domain	Domain
PF12661	hEGF	415 → 434	Human growth factor-like EGF	Domain
PF12661	hEGF	501 → 520	Human growth factor-like EGF	Domain
PF12661	hEGF	587 → 606	Human growth factor-like EGF	Domain
PF12661	hEGF	718 → 737	Human growth factor-like EGF	Domain
PF00053	Laminin_EGF	759 → 804	Laminin EGF domain	Domain
PF00053	Laminin_EGF	802 → 838	Laminin EGF domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in muscle (at protein level). {ECO:0000269|PubMed:27460346}.

Sequence

MVISLNSCLSFICLLLCHWIGTASPLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSC
TDILNWFKCTRHRVSYRTAYRHGEKTMYRRKSQCCPGFYESGEMCVPHCADKCVHGRCIA
PNTCQCEPGWGGTNCSSACDGDHWGPHCTSRCQCKNGALCNPITGACHCAAGFRGWRCED
RCEQGTYGNDCHQRCQCQNGATCDHVTGECRCPPGYTGAFCEDLCPPGKHGPQCEQRCPC
QNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRFGKNCSQECQCHNGGTCDAATGQCHCSP
GYTGERCQDECPVGTYGVLCAETCQCVNGGKCYHVSGACLCEAGFAGERCEARLCPEGLY
GIKCDKRCPCHLENTHSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGAD
CDSVTGKCTCAPGFKGIDCSTPCPLGTYGINCSSRCGCKNDAVCSPVDGSCTCKAGWHGV
DCSIRCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGEKCELPCQDGTYGLNCAE
RCDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGIC
ECAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVC
PSGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHN
GAFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGF
MGRHCEQKCPSGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLN
SLSRTSTALPADSYQIGAIAGIIILVLVVLFLLALFIIYRHKQKGKESSMPAVTYTPAMR
VVNADYTISGTLPHSNGGNANSHYFTNPSYHTLTQCATSPHVNNRDRMTVTKSKNNQLFV
NLKNVNPGKRGPVGDCTGTLPADWKHGGYLNELGAFGLDRSYMGKSLKDLGKNSEYNSSN
CSLSSSENPYATIKDPPVLIPKSSECGYVEMKSPARRDSPYAEINNSTSANRNVYEVEPT
VSVVQGVFSNNGRLSQDPYDLPKNSHIPCHYDLLPVRDSSSSPKQEDSGGSSSNSSSSSE

Sequence length

1140

Interactions

View interactions

	KEGG
	Efferocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital myopathy 10b, mild variant	Pathogenic; Likely pathogenic	rs2479813429, rs2479778910, rs2479531357, rs2479708318, rs1013163272, rs387907072, rs387907073	RCV003152534 RCV003152537 RCV003152538 RCV003152539 RCV003152540 RCV000023956 RCV000023957 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
MEGF10-related myopathy	Pathogenic; Likely pathogenic	rs1234596293, rs1766329158, rs2126999837, rs1247305358, rs2126934788, rs2127045645, rs2126973413, rs2479766812, rs1279221790, rs931073338, rs1215256187, rs199750143, rs2479650289, rs1765917272, rs2479702385 View all (21 more)	RCV001383136 RCV001386616 RCV001966111 RCV002023271 RCV002007533 View all (32 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL MYOPATHY 10A, SEVERE VARIANT	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGLUTITION DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET MYOPATHY, AREFLEXIA, RESPIRATORY DISTRESS, DYSPHAGIA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET MYOPATHY-AREFLEXIA-RESPIRATORY DISTRESS-DYSPHAGIA SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEGF10-related disorder	Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECTUM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28536440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	28536440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bilateral Vestibulopathy	Bilateral vestibulopathy	Pubtator	23453856, 34828389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	27170117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital myopathy (disorder)	Congenital myopathy	BEFREE	22371254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	22101682, 23453856, 27170117, 27460346, 28498977		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deglutition Disorders	Dysphagia	CTD_human_DG	22101682		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deglutition Disorders	Deglutition disorder	Pubtator	23453856, 34828389	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deglutition Disorders	Dysphagia	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dental Caries	Dental caries	Pubtator	29859070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Early-onset myopathy-areflexia-respiratory distress-dysphagia syndrome	Myopathy-Areflexia-Respiratory Distress-Dysphagia Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Dysphagia	Esophageal Dysphagia	CTD_human_DG	22101682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29887919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29887919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MINICORE MYOPATHY WITH EXTERNAL OPHTHALMOPLEGIA (disorder)	Minicore myopathy with external ophthalmoplegia	BEFREE	26802438, 27460346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	22101682, 22371254, 23453856, 25111228, 26802438, 27170117, 27460346, 28498977, 29128256, 30802937, 31267131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	CTD_human_DG	22101682		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY, AREFLEXIA, RESPIRATORY DISTRESS, AND DYSPHAGIA, EARLY-ONSET	Myopathy, Areflexia, Respiratory Distress, And Dysphagia	CLINGEN_DG	18056409, 22101682, 22371254, 23453856, 27460346, 28498977		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, AREFLEXIA, RESPIRATORY DISTRESS, AND DYSPHAGIA, EARLY-ONSET	Myopathy, Areflexia, Respiratory Distress, And Dysphagia	UNIPROT_DG	22101682, 22371254, 23954233, 27170117, 28498977		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, AREFLEXIA, RESPIRATORY DISTRESS, AND DYSPHAGIA, EARLY-ONSET	Myopathy, Areflexia, Respiratory Distress, And Dysphagia	ORPHANET_DG	22101682, 23453856		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, AREFLEXIA, RESPIRATORY DISTRESS, AND DYSPHAGIA, EARLY-ONSET	Myopathy, Areflexia, Respiratory Distress, And Dysphagia	CLINVAR_DG	22101682, 22371254, 23453856, 23954233		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, AREFLEXIA, RESPIRATORY DISTRESS, AND DYSPHAGIA, EARLY-ONSET	Myopathy, Areflexia, Respiratory Distress, And Dysphagia	GENOMICS_ENGLAND_DG	22101682, 22371254		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, AREFLEXIA, RESPIRATORY DISTRESS, AND DYSPHAGIA, EARLY-ONSET	Myopathy, Areflexia, Respiratory Distress, And Dysphagia	BEFREE	23453856, 27170117, 27460346, 28498977		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, AREFLEXIA, RESPIRATORY DISTRESS, AND DYSPHAGIA, EARLY-ONSET, MILD VARIANT	Myopathy, Areflexia, Respiratory Distress, And Dysphagia	ORPHANET_DG	22101682, 23453856		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, AREFLEXIA, RESPIRATORY DISTRESS, AND DYSPHAGIA, EARLY-ONSET, MILD VARIANT	Myopathy, Areflexia, Respiratory Distress, And Dysphagia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonia Congenita	Myotonia congenita	Pubtator	34828389, 36349186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal Hypotonia	Hypotonia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27862318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20828568, 27862318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27862318	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Dysphagia	Oropharyngeal Dysphagia	CTD_human_DG	22101682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	CTD_human_DG	22101682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	26802438, 29128256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	34285060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18179784		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18179784		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	18179784	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	29503163		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	34434692	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

MEGF10 (multiple EGF like domains 10)