Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84456
Gene name	L3MBTL histone methyl-lysine binding protein 3
Gene symbol	L3MBTL3
Synonyms (NCBI Gene)	MBT-1MBT1
Chromosome	6
Chromosome location	6q23.1
Summary	This gene encodes a member of the malignant brain tumor (MBT) family of chromatin interacting transcriptional repressors. Members of this family function as methyl-lysine readers, which recognize methylated lysine residues on histone protein tails, and ar

233

Show/Hide all (233)

miRTarBase ID	miRNA	Experiments
MIRT1102952	hsa-miR-183	CLIP-seq
MIRT1102953	hsa-miR-203	CLIP-seq
MIRT1102954	hsa-miR-3163	CLIP-seq
MIRT1102955	hsa-miR-410	CLIP-seq
MIRT1102956	hsa-miR-4684-3p	CLIP-seq
MIRT1102957	hsa-miR-4698	CLIP-seq
MIRT1102958	hsa-miR-218	CLIP-seq
MIRT1102959	hsa-miR-3065-5p	CLIP-seq
MIRT1102960	hsa-miR-3122	CLIP-seq
MIRT1102961	hsa-miR-3153	CLIP-seq
MIRT1102962	hsa-miR-3913-5p	CLIP-seq
MIRT1102963	hsa-miR-421	CLIP-seq
MIRT1102964	hsa-miR-4272	CLIP-seq
MIRT1102965	hsa-miR-4275	CLIP-seq
MIRT1102966	hsa-miR-451	CLIP-seq
MIRT1102967	hsa-miR-4668-5p	CLIP-seq
MIRT1102957	hsa-miR-4698	CLIP-seq
MIRT1102968	hsa-miR-520d-5p	CLIP-seq
MIRT1102969	hsa-miR-524-5p	CLIP-seq
MIRT1102970	hsa-miR-636	CLIP-seq
MIRT2028172	hsa-miR-3126-3p	CLIP-seq
MIRT2028173	hsa-miR-3660	CLIP-seq
MIRT2028174	hsa-miR-4526	CLIP-seq
MIRT2259333	hsa-miR-1298	CLIP-seq
MIRT2259334	hsa-miR-1302	CLIP-seq
MIRT2259335	hsa-miR-3158-5p	CLIP-seq
MIRT2028173	hsa-miR-3660	CLIP-seq
MIRT2259336	hsa-miR-4298	CLIP-seq
MIRT2259337	hsa-miR-4418	CLIP-seq
MIRT2028174	hsa-miR-4526	CLIP-seq
MIRT2259338	hsa-miR-509-3-5p	CLIP-seq
MIRT2259339	hsa-miR-509-5p	CLIP-seq
MIRT2259340	hsa-miR-556-5p	CLIP-seq
MIRT2559617	hsa-miR-105	CLIP-seq
MIRT2559618	hsa-miR-106a	CLIP-seq
MIRT2559619	hsa-miR-106b	CLIP-seq
MIRT2559620	hsa-miR-10a	CLIP-seq
MIRT2559621	hsa-miR-10b	CLIP-seq
MIRT2559622	hsa-miR-1267	CLIP-seq
MIRT2559623	hsa-miR-1283	CLIP-seq
MIRT2559624	hsa-miR-1288	CLIP-seq
MIRT2559625	hsa-miR-132	CLIP-seq
MIRT2559626	hsa-miR-1324	CLIP-seq
MIRT2559627	hsa-miR-149	CLIP-seq
MIRT2559628	hsa-miR-17	CLIP-seq
MIRT2559629	hsa-miR-182	CLIP-seq
MIRT1102952	hsa-miR-183	CLIP-seq
MIRT2559630	hsa-miR-186	CLIP-seq
MIRT2559631	hsa-miR-1910	CLIP-seq
MIRT2559632	hsa-miR-193a-3p	CLIP-seq
MIRT2559633	hsa-miR-193b	CLIP-seq
MIRT1102953	hsa-miR-203	CLIP-seq
MIRT2559634	hsa-miR-20a	CLIP-seq
MIRT2559635	hsa-miR-20b	CLIP-seq
MIRT2559636	hsa-miR-212	CLIP-seq
MIRT2559637	hsa-miR-219-2-3p	CLIP-seq
MIRT2559638	hsa-miR-221	CLIP-seq
MIRT2559639	hsa-miR-222	CLIP-seq
MIRT2559640	hsa-miR-2277-3p	CLIP-seq
MIRT2559641	hsa-miR-2681	CLIP-seq
MIRT2559642	hsa-miR-2964a-3p	CLIP-seq
MIRT2559643	hsa-miR-299-5p	CLIP-seq
MIRT2559644	hsa-miR-3064-5p	CLIP-seq
MIRT2559645	hsa-miR-30a	CLIP-seq
MIRT2559646	hsa-miR-30b	CLIP-seq
MIRT2559647	hsa-miR-30c	CLIP-seq
MIRT2559648	hsa-miR-30d	CLIP-seq
MIRT2559649	hsa-miR-30e	CLIP-seq
MIRT2559650	hsa-miR-3121-3p	CLIP-seq
MIRT2028172	hsa-miR-3126-3p	CLIP-seq
MIRT2559651	hsa-miR-3133	CLIP-seq
MIRT2559652	hsa-miR-3152-5p	CLIP-seq
MIRT1102954	hsa-miR-3163	CLIP-seq
MIRT2559653	hsa-miR-3169	CLIP-seq
MIRT2559654	hsa-miR-3200-3p	CLIP-seq
MIRT2559655	hsa-miR-3591-5p	CLIP-seq
MIRT2559656	hsa-miR-3607-3p	CLIP-seq
MIRT2559657	hsa-miR-3609	CLIP-seq
MIRT2559658	hsa-miR-3647-3p	CLIP-seq
MIRT2559659	hsa-miR-3667-5p	CLIP-seq
MIRT2559660	hsa-miR-3670	CLIP-seq
MIRT2559661	hsa-miR-3672	CLIP-seq
MIRT2559662	hsa-miR-3686	CLIP-seq
MIRT2559663	hsa-miR-371b-5p	CLIP-seq
MIRT2559664	hsa-miR-374a	CLIP-seq
MIRT2559665	hsa-miR-374b	CLIP-seq
MIRT2559666	hsa-miR-409-3p	CLIP-seq
MIRT1102955	hsa-miR-410	CLIP-seq
MIRT2559667	hsa-miR-425	CLIP-seq
MIRT2559668	hsa-miR-4252	CLIP-seq
MIRT2559669	hsa-miR-4255	CLIP-seq
MIRT2559670	hsa-miR-4423-3p	CLIP-seq
MIRT2559671	hsa-miR-4452	CLIP-seq
MIRT2559672	hsa-miR-4470	CLIP-seq
MIRT2559673	hsa-miR-4474-5p	CLIP-seq
MIRT2559674	hsa-miR-4499	CLIP-seq
MIRT2559675	hsa-miR-4652-3p	CLIP-seq
MIRT2559676	hsa-miR-4655-5p	CLIP-seq
MIRT2559677	hsa-miR-4662a-5p	CLIP-seq
MIRT2559678	hsa-miR-4676-5p	CLIP-seq
MIRT1102956	hsa-miR-4684-3p	CLIP-seq
MIRT1102957	hsa-miR-4698	CLIP-seq
MIRT2559679	hsa-miR-4704-5p	CLIP-seq
MIRT2559680	hsa-miR-4724-3p	CLIP-seq
MIRT2559681	hsa-miR-4725-5p	CLIP-seq
MIRT2559682	hsa-miR-4729	CLIP-seq
MIRT2559683	hsa-miR-4735-5p	CLIP-seq
MIRT2559684	hsa-miR-4742-3p	CLIP-seq
MIRT2559685	hsa-miR-4744	CLIP-seq
MIRT2559686	hsa-miR-4762-3p	CLIP-seq
MIRT2559687	hsa-miR-4765	CLIP-seq
MIRT2559688	hsa-miR-4766-5p	CLIP-seq
MIRT2559689	hsa-miR-4774-3p	CLIP-seq
MIRT2559690	hsa-miR-4794	CLIP-seq
MIRT2559691	hsa-miR-4796-3p	CLIP-seq
MIRT2559692	hsa-miR-499-3p	CLIP-seq
MIRT2559693	hsa-miR-499a-3p	CLIP-seq
MIRT2559694	hsa-miR-504	CLIP-seq
MIRT2559695	hsa-miR-518a-5p	CLIP-seq
MIRT2559696	hsa-miR-519a	CLIP-seq
MIRT2559697	hsa-miR-519b-3p	CLIP-seq
MIRT2559698	hsa-miR-519c-3p	CLIP-seq
MIRT2559699	hsa-miR-519d	CLIP-seq
MIRT2559700	hsa-miR-527	CLIP-seq
MIRT2559701	hsa-miR-548ad	CLIP-seq
MIRT2559702	hsa-miR-548ah	CLIP-seq
MIRT2559703	hsa-miR-548l	CLIP-seq
MIRT2559704	hsa-miR-548v	CLIP-seq
MIRT2259340	hsa-miR-556-5p	CLIP-seq
MIRT2559705	hsa-miR-575	CLIP-seq
MIRT2559706	hsa-miR-579	CLIP-seq
MIRT2559707	hsa-miR-586	CLIP-seq
MIRT2559708	hsa-miR-593	CLIP-seq
MIRT2559709	hsa-miR-600	CLIP-seq
MIRT2559710	hsa-miR-617	CLIP-seq
MIRT2559711	hsa-miR-634	CLIP-seq
MIRT2559712	hsa-miR-643	CLIP-seq
MIRT2559713	hsa-miR-659	CLIP-seq
MIRT2559714	hsa-miR-760	CLIP-seq
MIRT2559715	hsa-miR-888	CLIP-seq
MIRT2559716	hsa-miR-892b	CLIP-seq
MIRT2559717	hsa-miR-93	CLIP-seq
MIRT2559617	hsa-miR-105	CLIP-seq
MIRT2559618	hsa-miR-106a	CLIP-seq
MIRT2559619	hsa-miR-106b	CLIP-seq
MIRT2559620	hsa-miR-10a	CLIP-seq
MIRT2559621	hsa-miR-10b	CLIP-seq
MIRT2559622	hsa-miR-1267	CLIP-seq
MIRT2559624	hsa-miR-1288	CLIP-seq
MIRT2559625	hsa-miR-132	CLIP-seq
MIRT2559626	hsa-miR-1324	CLIP-seq
MIRT2559627	hsa-miR-149	CLIP-seq
MIRT2559628	hsa-miR-17	CLIP-seq
MIRT2559629	hsa-miR-182	CLIP-seq
MIRT1102952	hsa-miR-183	CLIP-seq
MIRT2559631	hsa-miR-1910	CLIP-seq
MIRT2559632	hsa-miR-193a-3p	CLIP-seq
MIRT2559633	hsa-miR-193b	CLIP-seq
MIRT1102953	hsa-miR-203	CLIP-seq
MIRT2559634	hsa-miR-20a	CLIP-seq
MIRT2559635	hsa-miR-20b	CLIP-seq
MIRT2559636	hsa-miR-212	CLIP-seq
MIRT2559637	hsa-miR-219-2-3p	CLIP-seq
MIRT2559640	hsa-miR-2277-3p	CLIP-seq
MIRT2559641	hsa-miR-2681	CLIP-seq
MIRT2559642	hsa-miR-2964a-3p	CLIP-seq
MIRT2559643	hsa-miR-299-5p	CLIP-seq
MIRT2559644	hsa-miR-3064-5p	CLIP-seq
MIRT2559645	hsa-miR-30a	CLIP-seq
MIRT2559646	hsa-miR-30b	CLIP-seq
MIRT2559647	hsa-miR-30c	CLIP-seq
MIRT2559648	hsa-miR-30d	CLIP-seq
MIRT2559649	hsa-miR-30e	CLIP-seq
MIRT2559650	hsa-miR-3121-3p	CLIP-seq
MIRT2028172	hsa-miR-3126-3p	CLIP-seq
MIRT2559652	hsa-miR-3152-5p	CLIP-seq
MIRT1102954	hsa-miR-3163	CLIP-seq
MIRT2559653	hsa-miR-3169	CLIP-seq
MIRT2559654	hsa-miR-3200-3p	CLIP-seq
MIRT2559655	hsa-miR-3591-5p	CLIP-seq
MIRT2559656	hsa-miR-3607-3p	CLIP-seq
MIRT2559657	hsa-miR-3609	CLIP-seq
MIRT2559658	hsa-miR-3647-3p	CLIP-seq
MIRT2559660	hsa-miR-3670	CLIP-seq
MIRT2559661	hsa-miR-3672	CLIP-seq
MIRT2559662	hsa-miR-3686	CLIP-seq
MIRT2559663	hsa-miR-371b-5p	CLIP-seq
MIRT2559664	hsa-miR-374a	CLIP-seq
MIRT2559665	hsa-miR-374b	CLIP-seq
MIRT2559666	hsa-miR-409-3p	CLIP-seq
MIRT1102955	hsa-miR-410	CLIP-seq
MIRT2559667	hsa-miR-425	CLIP-seq
MIRT2559668	hsa-miR-4252	CLIP-seq
MIRT2559669	hsa-miR-4255	CLIP-seq
MIRT2683721	hsa-miR-4307	CLIP-seq
MIRT2559670	hsa-miR-4423-3p	CLIP-seq
MIRT2559671	hsa-miR-4452	CLIP-seq
MIRT2559672	hsa-miR-4470	CLIP-seq
MIRT2559673	hsa-miR-4474-5p	CLIP-seq
MIRT2559674	hsa-miR-4499	CLIP-seq
MIRT2559675	hsa-miR-4652-3p	CLIP-seq
MIRT2559676	hsa-miR-4655-5p	CLIP-seq
MIRT2559677	hsa-miR-4662a-5p	CLIP-seq
MIRT2559678	hsa-miR-4676-5p	CLIP-seq
MIRT1102956	hsa-miR-4684-3p	CLIP-seq
MIRT1102957	hsa-miR-4698	CLIP-seq
MIRT2559679	hsa-miR-4704-5p	CLIP-seq
MIRT2559680	hsa-miR-4724-3p	CLIP-seq
MIRT2559681	hsa-miR-4725-5p	CLIP-seq
MIRT2559682	hsa-miR-4729	CLIP-seq
MIRT2559683	hsa-miR-4735-5p	CLIP-seq
MIRT2559686	hsa-miR-4762-3p	CLIP-seq
MIRT2559687	hsa-miR-4765	CLIP-seq
MIRT2559689	hsa-miR-4774-3p	CLIP-seq
MIRT2559690	hsa-miR-4794	CLIP-seq
MIRT2559691	hsa-miR-4796-3p	CLIP-seq
MIRT2559694	hsa-miR-504	CLIP-seq
MIRT2559695	hsa-miR-518a-5p	CLIP-seq
MIRT2559699	hsa-miR-519d	CLIP-seq
MIRT2559700	hsa-miR-527	CLIP-seq
MIRT2559702	hsa-miR-548ah	CLIP-seq
MIRT2259340	hsa-miR-556-5p	CLIP-seq
MIRT2559705	hsa-miR-575	CLIP-seq
MIRT2559706	hsa-miR-579	CLIP-seq
MIRT2559707	hsa-miR-586	CLIP-seq
MIRT2559708	hsa-miR-593	CLIP-seq
MIRT2559711	hsa-miR-634	CLIP-seq
MIRT2559712	hsa-miR-643	CLIP-seq
MIRT2559713	hsa-miR-659	CLIP-seq
MIRT2559714	hsa-miR-760	CLIP-seq
MIRT2559715	hsa-miR-888	CLIP-seq
MIRT2559716	hsa-miR-892b	CLIP-seq
MIRT2559717	hsa-miR-93	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IDA	33980486
GO:0005515	Function	Protein binding	IPI	17517653, 21516116, 22157815, 25416956, 26871637, 29030483, 29691401, 30442713, 31515488, 32296183, 32814053, 33980486
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	33980486
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030851	Process	Granulocyte differentiation	IEA
GO:0042393	Function	Histone binding	IBA
GO:0042802	Function	Identical protein binding	IPI	21516116, 25416956, 31515488, 32296183
GO:0043249	Process	Erythrocyte maturation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	29030483
GO:0046872	Function	Metal ion binding	IEA
GO:0140034	Function	Methylation-dependent protein binding	IPI	29691401
GO:0160217	Process	Negative regulation of transcription initiation-coupled chromatin remodeling	IDA	33980486
GO:2000058	Process	Regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IMP	29691401

MIM	HGNC	e!Ensembl
618844	23035	ENSG00000198945

Q96JM7

Protein name

Lethal(3)malignant brain tumor-like protein 3 (H-l(3)mbt-like protein 3) (L(3)mbt-like protein 3) (L3mbt-like 3) (MBT-1)

Protein function

Is a negative regulator of Notch target genes expression, required for RBPJ-mediated transcriptional repression (PubMed:29030483). It recruits KDM1A to Notch-responsive elements and promotes KDM1A-mediated H3K4me demethylation (PubMed:29030483).

PDB

1WJQ , 1WJS , 3UT1 , 4FL6 , 4L59 , 7RTE , 7RTI , 8Y76 , 8Y77

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02820	MBT	268 → 336	mbt repeat	Domain
PF02820	MBT	375 → 443	mbt repeat	Domain
PF02820	MBT	479 → 545	mbt repeat	Domain
PF00536	SAM_1	706 → 770	SAM domain (Sterile alpha motif)	Domain

Sequence

MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATA
TTTWMVPTAQEAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGMPFRLKDPVKVEGLQFC
ENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKKKPKLSLK
ADTKEDGEERDDEMENKQDVRILRGSQRARRKRRGDSAVLKQGLPPKGKKAWCWASYLEE
EKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDG
YSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFE
NQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASS
PHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMK
LEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPL
QPPLSPLELMEASEHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRL
SGEMPPASPSFPRNKRTDANESSSSPEIRDQHADDVKEDFEERTESEMRTSHEARGAREE
PTVQQAQRRSAVFLSFKSPIPCLPLRWEQQSKLLPTVAGIPASKVSKWSTDEVSEFIQSL
PGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNSHNEL

Sequence length

780

Interactions

View interactions

	KEGG
	Polycomb repressive complex

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29058716, 29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29915430		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	27432226, 39614330	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27432226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28115406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23626757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23626757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	28115406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30993446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	32349335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	24911414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	31152163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27432226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27432226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27432226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29915430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	27386562, 35088080	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30456721		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Diseases	Ovarian diseases	Pubtator	28115406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27432226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27432226	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27432226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27432226		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28115406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

L3MBTL3 (L3MBTL histone methyl-lysine binding protein 3)