Gene Gene information from NCBI Gene database.
Entrez ID 8445
Gene name Dual specificity tyrosine phosphorylation regulated kinase 2
Gene symbol DYRK2
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q15
Summary DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine res
miRNA miRNA information provided by mirtarbase database.
812
miRTarBase ID miRNA Experiments Reference
MIRT027110 hsa-miR-103a-3p Sequencing 20371350
MIRT027686 hsa-miR-98-5p Microarray 19088304
MIRT028150 hsa-miR-93-5p Sequencing 20371350
MIRT051470 hsa-let-7e-5p CLASH 23622248
MIRT028150 hsa-miR-93-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IDA 19287380
GO:0000166 Function Nucleotide binding IEA
GO:0000287 Function Magnesium ion binding IDA 9748265
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603496 3093 ENSG00000127334
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92630
Protein name Dual specificity tyrosine-phosphorylation-regulated kinase 2 (EC 2.7.12.1)
Protein function Serine/threonine-protein kinase involved in the regulation of the mitotic cell cycle, cell proliferation, apoptosis, organization of the cytoskeleton and neurite outgrowth. Functions in part via its role in ubiquitin-dependent proteasomal protei
PDB 3K2L , 3KVW , 4AZF , 5LXC , 5LXD , 5ZTN , 6HDP , 6HDR , 6K0J , 7AKF , 7AKH , 7DG4 , 7DH3 , 7DH9 , 7DHC , 7DHH , 7DHK , 7DHN , 7DHO , 7DHV , 7DJO , 7DL6 , 8HLT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 222 535 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Testis, after the onset of spermatogenesis. {ECO:0000269|PubMed:9748265}.
Sequence
MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWL
RRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
Sequence length 601
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of TP53 Activity through Phosphorylation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANDROGENETIC ALOPECIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL STROMAL TUMORS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 19818968, 26341817
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 12874018
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 23362280, 23791882, 25712377, 26341817, 27721402, 27746162, 28502078
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 25095982 Associate
★☆☆☆☆
Found in Text Mining only
Bronchioloalveolar Adenocarcinoma Lung adenocarcinoma BEFREE 19818968
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 27532268, 28260923, 28502078
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 27532268 Inhibit
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 36934104 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 1 Diabetes mellitus, type 1 Pubtator 35903753 Associate
★☆☆☆☆
Found in Text Mining only
Gastrointestinal Stromal Sarcoma Gastrointestinal stromal tumor CTD_human_DG 27793025
★☆☆☆☆
Found in Text Mining only