Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84447
Gene name	Synoviolin 1
Gene symbol	SYVN1
Synonyms (NCBI Gene)	DER3HRD1
Chromosome	11
Chromosome location	11q13.1
Summary	This gene encodes a protein involved in endoplasmic reticulum (ER)-associated degradation. The encoded protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquiti

407

Show/Hide all (407)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016772	hsa-miR-335-5p	Microarray	18185580
MIRT052635	hsa-let-7a-5p	CLASH	23622248
MIRT048209	hsa-miR-196a-5p	CLASH	23622248
MIRT040147	hsa-miR-615-3p	CLASH	23622248
MIRT652890	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT652891	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT652889	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT652888	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT652887	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT652886	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT652885	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT652884	hsa-miR-1292-5p	HITS-CLIP	23824327
MIRT652883	hsa-miR-4471	HITS-CLIP	23824327
MIRT652882	hsa-miR-8059	HITS-CLIP	23824327
MIRT652881	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT652880	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT652879	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT737084	hsa-miR-513a-3p	Luciferase reporter assayWestern blottingMicroarrayImmunoprecipitaion (IP)ImmunofluorescenceqRT-PCR	33530981
MIRT652890	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT652891	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT652889	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT652888	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT652887	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT652886	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT652885	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT652884	hsa-miR-1292-5p	HITS-CLIP	23824327
MIRT652883	hsa-miR-4471	HITS-CLIP	23824327
MIRT652882	hsa-miR-8059	HITS-CLIP	23824327
MIRT652881	hsa-miR-6509-3p	HITS-CLIP	23824327
MIRT652880	hsa-miR-4436b-5p	HITS-CLIP	23824327
MIRT652879	hsa-miR-3692-3p	HITS-CLIP	23824327
MIRT1407987	hsa-miR-1270	CLIP-seq
MIRT1407988	hsa-miR-185	CLIP-seq
MIRT1407989	hsa-miR-3125	CLIP-seq
MIRT1407990	hsa-miR-3916	CLIP-seq
MIRT1407991	hsa-miR-4306	CLIP-seq
MIRT1407992	hsa-miR-4446-3p	CLIP-seq
MIRT1407993	hsa-miR-4476	CLIP-seq
MIRT1407994	hsa-miR-4530	CLIP-seq
MIRT1407995	hsa-miR-4531	CLIP-seq
MIRT1407996	hsa-miR-4644	CLIP-seq
MIRT1407997	hsa-miR-4656	CLIP-seq
MIRT1407998	hsa-miR-4709-3p	CLIP-seq
MIRT1407999	hsa-miR-571	CLIP-seq
MIRT1408000	hsa-miR-620	CLIP-seq
MIRT1408001	hsa-miR-922	CLIP-seq
MIRT1408002	hsa-miR-103b	CLIP-seq
MIRT1408003	hsa-miR-1207-5p	CLIP-seq
MIRT1408004	hsa-miR-1276	CLIP-seq
MIRT1408005	hsa-miR-1286	CLIP-seq
MIRT1408006	hsa-miR-1289	CLIP-seq
MIRT1408007	hsa-miR-1292	CLIP-seq
MIRT1408008	hsa-miR-1587	CLIP-seq
MIRT1408009	hsa-miR-200b	CLIP-seq
MIRT1408010	hsa-miR-200c	CLIP-seq
MIRT1408011	hsa-miR-2278	CLIP-seq
MIRT1408012	hsa-miR-2467-3p	CLIP-seq
MIRT1408013	hsa-miR-300	CLIP-seq
MIRT1408014	hsa-miR-3127-3p	CLIP-seq
MIRT1408015	hsa-miR-3152-5p	CLIP-seq
MIRT1408016	hsa-miR-3158-3p	CLIP-seq
MIRT1408017	hsa-miR-3184	CLIP-seq
MIRT1408018	hsa-miR-3188	CLIP-seq
MIRT1408019	hsa-miR-3198	CLIP-seq
MIRT1408020	hsa-miR-3614-5p	CLIP-seq
MIRT1408021	hsa-miR-371b-5p	CLIP-seq
MIRT1408022	hsa-miR-376a	CLIP-seq
MIRT1408023	hsa-miR-376b	CLIP-seq
MIRT1408024	hsa-miR-378g	CLIP-seq
MIRT1408025	hsa-miR-381	CLIP-seq
MIRT1408026	hsa-miR-423-5p	CLIP-seq
MIRT1408027	hsa-miR-4283	CLIP-seq
MIRT1408028	hsa-miR-429	CLIP-seq
MIRT1408029	hsa-miR-4294	CLIP-seq
MIRT1408030	hsa-miR-4300	CLIP-seq
MIRT1408031	hsa-miR-4309	CLIP-seq
MIRT1408032	hsa-miR-4314	CLIP-seq
MIRT1408033	hsa-miR-432	CLIP-seq
MIRT1408034	hsa-miR-4418	CLIP-seq
MIRT1408035	hsa-miR-4436a	CLIP-seq
MIRT1408036	hsa-miR-4443	CLIP-seq
MIRT1407992	hsa-miR-4446-3p	CLIP-seq
MIRT1408037	hsa-miR-4453	CLIP-seq
MIRT1408038	hsa-miR-4468	CLIP-seq
MIRT1408039	hsa-miR-4489	CLIP-seq
MIRT1408040	hsa-miR-4492	CLIP-seq
MIRT1408041	hsa-miR-4498	CLIP-seq
MIRT1408042	hsa-miR-4505	CLIP-seq
MIRT1408043	hsa-miR-452	CLIP-seq
MIRT1408044	hsa-miR-4538	CLIP-seq
MIRT1408045	hsa-miR-4633-3p	CLIP-seq
MIRT1407997	hsa-miR-4656	CLIP-seq
MIRT1408046	hsa-miR-4667-5p	CLIP-seq
MIRT1408047	hsa-miR-4675	CLIP-seq
MIRT1408048	hsa-miR-4676-3p	CLIP-seq
MIRT1408049	hsa-miR-4688	CLIP-seq
MIRT1408050	hsa-miR-4700-5p	CLIP-seq
MIRT1408051	hsa-miR-4721	CLIP-seq
MIRT1408052	hsa-miR-4731-5p	CLIP-seq
MIRT1408053	hsa-miR-4736	CLIP-seq
MIRT1408054	hsa-miR-4738-5p	CLIP-seq
MIRT1408055	hsa-miR-4741	CLIP-seq
MIRT1408056	hsa-miR-4749-3p	CLIP-seq
MIRT1408057	hsa-miR-4763-3p	CLIP-seq
MIRT1408058	hsa-miR-485-5p	CLIP-seq
MIRT1408059	hsa-miR-486-3p	CLIP-seq
MIRT1408060	hsa-miR-509-3-5p	CLIP-seq
MIRT1408061	hsa-miR-509-5p	CLIP-seq
MIRT1408062	hsa-miR-516b	CLIP-seq
MIRT1408063	hsa-miR-610	CLIP-seq
MIRT1408064	hsa-miR-637	CLIP-seq
MIRT1408065	hsa-miR-762	CLIP-seq
MIRT1408066	hsa-miR-766	CLIP-seq
MIRT1408067	hsa-miR-767-3p	CLIP-seq
MIRT1408068	hsa-miR-920	CLIP-seq
MIRT1407999	hsa-miR-571	CLIP-seq
MIRT1408002	hsa-miR-103b	CLIP-seq
MIRT2122329	hsa-miR-105	CLIP-seq
MIRT2122330	hsa-miR-1225-5p	CLIP-seq
MIRT2122331	hsa-miR-1253	CLIP-seq
MIRT2122332	hsa-miR-1254	CLIP-seq
MIRT1408006	hsa-miR-1289	CLIP-seq
MIRT1408007	hsa-miR-1292	CLIP-seq
MIRT2122333	hsa-miR-134	CLIP-seq
MIRT2122334	hsa-miR-1976	CLIP-seq
MIRT1408009	hsa-miR-200b	CLIP-seq
MIRT1408010	hsa-miR-200c	CLIP-seq
MIRT1408012	hsa-miR-2467-3p	CLIP-seq
MIRT1408013	hsa-miR-300	CLIP-seq
MIRT2122335	hsa-miR-3116	CLIP-seq
MIRT2122336	hsa-miR-3118	CLIP-seq
MIRT1408014	hsa-miR-3127-3p	CLIP-seq
MIRT2122337	hsa-miR-3150a-3p	CLIP-seq
MIRT1408015	hsa-miR-3152-5p	CLIP-seq
MIRT1408016	hsa-miR-3158-3p	CLIP-seq
MIRT2122338	hsa-miR-3164	CLIP-seq
MIRT2122339	hsa-miR-3175	CLIP-seq
MIRT2122340	hsa-miR-3178	CLIP-seq
MIRT1408017	hsa-miR-3184	CLIP-seq
MIRT1408018	hsa-miR-3188	CLIP-seq
MIRT2122341	hsa-miR-3189-3p	CLIP-seq
MIRT1408019	hsa-miR-3198	CLIP-seq
MIRT2122342	hsa-miR-3199	CLIP-seq
MIRT2122343	hsa-miR-34a	CLIP-seq
MIRT2122344	hsa-miR-34c-5p	CLIP-seq
MIRT1408020	hsa-miR-3614-5p	CLIP-seq
MIRT2122345	hsa-miR-3667-3p	CLIP-seq
MIRT2122346	hsa-miR-3677-5p	CLIP-seq
MIRT2122347	hsa-miR-3690	CLIP-seq
MIRT1408022	hsa-miR-376a	CLIP-seq
MIRT1408023	hsa-miR-376b	CLIP-seq
MIRT1408025	hsa-miR-381	CLIP-seq
MIRT2122348	hsa-miR-3936	CLIP-seq
MIRT2122349	hsa-miR-3978	CLIP-seq
MIRT1408026	hsa-miR-423-5p	CLIP-seq
MIRT2122350	hsa-miR-4254	CLIP-seq
MIRT2122351	hsa-miR-4279	CLIP-seq
MIRT1408028	hsa-miR-429	CLIP-seq
MIRT1408029	hsa-miR-4294	CLIP-seq
MIRT2122352	hsa-miR-4297	CLIP-seq
MIRT1408030	hsa-miR-4300	CLIP-seq
MIRT2122353	hsa-miR-4302	CLIP-seq
MIRT1408031	hsa-miR-4309	CLIP-seq
MIRT1408032	hsa-miR-4314	CLIP-seq
MIRT1408033	hsa-miR-432	CLIP-seq
MIRT1408034	hsa-miR-4418	CLIP-seq
MIRT1408036	hsa-miR-4443	CLIP-seq
MIRT1407992	hsa-miR-4446-3p	CLIP-seq
MIRT2122354	hsa-miR-449a	CLIP-seq
MIRT2122355	hsa-miR-449b	CLIP-seq
MIRT1408042	hsa-miR-4505	CLIP-seq
MIRT2122356	hsa-miR-4506	CLIP-seq
MIRT2122357	hsa-miR-4515	CLIP-seq
MIRT1408043	hsa-miR-452	CLIP-seq
MIRT1408045	hsa-miR-4633-3p	CLIP-seq
MIRT1407997	hsa-miR-4656	CLIP-seq
MIRT1408046	hsa-miR-4667-5p	CLIP-seq
MIRT1408048	hsa-miR-4676-3p	CLIP-seq
MIRT2122358	hsa-miR-4683	CLIP-seq
MIRT1408049	hsa-miR-4688	CLIP-seq
MIRT1408050	hsa-miR-4700-5p	CLIP-seq
MIRT1408051	hsa-miR-4721	CLIP-seq
MIRT2122359	hsa-miR-4727-5p	CLIP-seq
MIRT1408052	hsa-miR-4731-5p	CLIP-seq
MIRT2122360	hsa-miR-4740-3p	CLIP-seq
MIRT1408056	hsa-miR-4749-3p	CLIP-seq
MIRT2122361	hsa-miR-4769-3p	CLIP-seq
MIRT2122362	hsa-miR-4772-5p	CLIP-seq
MIRT2122363	hsa-miR-4795-5p	CLIP-seq
MIRT2122364	hsa-miR-4799-5p	CLIP-seq
MIRT1408059	hsa-miR-486-3p	CLIP-seq
MIRT2122365	hsa-miR-502-5p	CLIP-seq
MIRT1408060	hsa-miR-509-3-5p	CLIP-seq
MIRT1408061	hsa-miR-509-5p	CLIP-seq
MIRT1408062	hsa-miR-516b	CLIP-seq
MIRT2122366	hsa-miR-548g	CLIP-seq
MIRT2122367	hsa-miR-555	CLIP-seq
MIRT1407999	hsa-miR-571	CLIP-seq
MIRT2122368	hsa-miR-580	CLIP-seq
MIRT2122369	hsa-miR-604	CLIP-seq
MIRT1408063	hsa-miR-610	CLIP-seq
MIRT2122370	hsa-miR-635	CLIP-seq
MIRT1408064	hsa-miR-637	CLIP-seq
MIRT2122371	hsa-miR-647	CLIP-seq
MIRT2122372	hsa-miR-661	CLIP-seq
MIRT1408066	hsa-miR-766	CLIP-seq
MIRT2122373	hsa-miR-875-3p	CLIP-seq
MIRT1408068	hsa-miR-920	CLIP-seq
MIRT2122374	hsa-miR-939	CLIP-seq
MIRT1407992	hsa-miR-4446-3p	CLIP-seq
MIRT2122371	hsa-miR-647	CLIP-seq
MIRT2122329	hsa-miR-105	CLIP-seq
MIRT2344564	hsa-miR-1202	CLIP-seq
MIRT2122330	hsa-miR-1225-5p	CLIP-seq
MIRT2122331	hsa-miR-1253	CLIP-seq
MIRT2122332	hsa-miR-1254	CLIP-seq
MIRT2344565	hsa-miR-125a-5p	CLIP-seq
MIRT2344566	hsa-miR-125b	CLIP-seq
MIRT1407987	hsa-miR-1270	CLIP-seq
MIRT2344567	hsa-miR-1273g	CLIP-seq
MIRT2344568	hsa-miR-1275	CLIP-seq
MIRT1408006	hsa-miR-1289	CLIP-seq
MIRT1408007	hsa-miR-1292	CLIP-seq
MIRT2122333	hsa-miR-134	CLIP-seq
MIRT2344569	hsa-miR-147	CLIP-seq
MIRT1407988	hsa-miR-185	CLIP-seq
MIRT2344570	hsa-miR-1915	CLIP-seq
MIRT2344571	hsa-miR-194	CLIP-seq
MIRT2122334	hsa-miR-1976	CLIP-seq
MIRT1408009	hsa-miR-200b	CLIP-seq
MIRT1408010	hsa-miR-200c	CLIP-seq
MIRT2344572	hsa-miR-208a	CLIP-seq
MIRT2344573	hsa-miR-208b	CLIP-seq
MIRT2344574	hsa-miR-219-1-3p	CLIP-seq
MIRT1408013	hsa-miR-300	CLIP-seq
MIRT2122335	hsa-miR-3116	CLIP-seq
MIRT2122336	hsa-miR-3118	CLIP-seq
MIRT2122337	hsa-miR-3150a-3p	CLIP-seq
MIRT1408016	hsa-miR-3158-3p	CLIP-seq
MIRT2122338	hsa-miR-3164	CLIP-seq
MIRT2122339	hsa-miR-3175	CLIP-seq
MIRT1408017	hsa-miR-3184	CLIP-seq
MIRT2344575	hsa-miR-3185	CLIP-seq
MIRT1408018	hsa-miR-3188	CLIP-seq
MIRT2122341	hsa-miR-3189-3p	CLIP-seq
MIRT1408019	hsa-miR-3198	CLIP-seq
MIRT2122342	hsa-miR-3199	CLIP-seq
MIRT2344576	hsa-miR-3545-5p	CLIP-seq
MIRT1408020	hsa-miR-3614-5p	CLIP-seq
MIRT2122347	hsa-miR-3690	CLIP-seq
MIRT1408025	hsa-miR-381	CLIP-seq
MIRT2344577	hsa-miR-3911	CLIP-seq
MIRT2122348	hsa-miR-3936	CLIP-seq
MIRT2344578	hsa-miR-3945	CLIP-seq
MIRT2344579	hsa-miR-3972	CLIP-seq
MIRT2344580	hsa-miR-3975	CLIP-seq
MIRT2122349	hsa-miR-3978	CLIP-seq
MIRT1408026	hsa-miR-423-5p	CLIP-seq
MIRT2122350	hsa-miR-4254	CLIP-seq
MIRT2344581	hsa-miR-4257	CLIP-seq
MIRT2344582	hsa-miR-4271	CLIP-seq
MIRT2344583	hsa-miR-4278	CLIP-seq
MIRT2122351	hsa-miR-4279	CLIP-seq
MIRT1408028	hsa-miR-429	CLIP-seq
MIRT1408029	hsa-miR-4294	CLIP-seq
MIRT2122352	hsa-miR-4297	CLIP-seq
MIRT1408030	hsa-miR-4300	CLIP-seq
MIRT2122353	hsa-miR-4302	CLIP-seq
MIRT1407991	hsa-miR-4306	CLIP-seq
MIRT1408031	hsa-miR-4309	CLIP-seq
MIRT1408032	hsa-miR-4314	CLIP-seq
MIRT2344584	hsa-miR-4319	CLIP-seq
MIRT1408033	hsa-miR-432	CLIP-seq
MIRT2344585	hsa-miR-4330	CLIP-seq
MIRT1408034	hsa-miR-4418	CLIP-seq
MIRT2344586	hsa-miR-4433	CLIP-seq
MIRT1408036	hsa-miR-4443	CLIP-seq
MIRT1407992	hsa-miR-4446-3p	CLIP-seq
MIRT2344587	hsa-miR-4446-5p	CLIP-seq
MIRT2344588	hsa-miR-4447	CLIP-seq
MIRT2344589	hsa-miR-4459	CLIP-seq
MIRT2344590	hsa-miR-4472	CLIP-seq
MIRT2344591	hsa-miR-4487	CLIP-seq
MIRT2122356	hsa-miR-4506	CLIP-seq
MIRT2344592	hsa-miR-4514	CLIP-seq
MIRT2122357	hsa-miR-4515	CLIP-seq
MIRT1408043	hsa-miR-452	CLIP-seq
MIRT2344593	hsa-miR-4525	CLIP-seq
MIRT1407995	hsa-miR-4531	CLIP-seq
MIRT1408045	hsa-miR-4633-3p	CLIP-seq
MIRT2344594	hsa-miR-4640-5p	CLIP-seq
MIRT1407996	hsa-miR-4644	CLIP-seq
MIRT2344595	hsa-miR-4645-5p	CLIP-seq
MIRT2344596	hsa-miR-4651	CLIP-seq
MIRT1407997	hsa-miR-4656	CLIP-seq
MIRT2344597	hsa-miR-4665-5p	CLIP-seq
MIRT1408046	hsa-miR-4667-5p	CLIP-seq
MIRT2344598	hsa-miR-4668-5p	CLIP-seq
MIRT2344599	hsa-miR-4673	CLIP-seq
MIRT1408048	hsa-miR-4676-3p	CLIP-seq
MIRT2344600	hsa-miR-4682	CLIP-seq
MIRT2122358	hsa-miR-4683	CLIP-seq
MIRT1408049	hsa-miR-4688	CLIP-seq
MIRT2344601	hsa-miR-4690-5p	CLIP-seq
MIRT2344602	hsa-miR-4691-3p	CLIP-seq
MIRT2344603	hsa-miR-4692	CLIP-seq
MIRT1408050	hsa-miR-4700-5p	CLIP-seq
MIRT1407998	hsa-miR-4709-3p	CLIP-seq
MIRT2344604	hsa-miR-4716-3p	CLIP-seq
MIRT1408051	hsa-miR-4721	CLIP-seq
MIRT2344605	hsa-miR-4723-5p	CLIP-seq
MIRT2344606	hsa-miR-4725-3p	CLIP-seq
MIRT2344607	hsa-miR-4726-3p	CLIP-seq
MIRT2344608	hsa-miR-4726-5p	CLIP-seq
MIRT2122359	hsa-miR-4727-5p	CLIP-seq
MIRT1408052	hsa-miR-4731-5p	CLIP-seq
MIRT2344609	hsa-miR-4732-3p	CLIP-seq
MIRT1408053	hsa-miR-4736	CLIP-seq
MIRT2122360	hsa-miR-4740-3p	CLIP-seq
MIRT1408056	hsa-miR-4749-3p	CLIP-seq
MIRT2344610	hsa-miR-4755-5p	CLIP-seq
MIRT2344611	hsa-miR-4768-3p	CLIP-seq
MIRT2122362	hsa-miR-4772-5p	CLIP-seq
MIRT1408059	hsa-miR-486-3p	CLIP-seq
MIRT1408060	hsa-miR-509-3-5p	CLIP-seq
MIRT1408061	hsa-miR-509-5p	CLIP-seq
MIRT1408062	hsa-miR-516b	CLIP-seq
MIRT2344612	hsa-miR-541	CLIP-seq
MIRT2344613	hsa-miR-548aa	CLIP-seq
MIRT2122366	hsa-miR-548g	CLIP-seq
MIRT2122367	hsa-miR-555	CLIP-seq
MIRT1407999	hsa-miR-571	CLIP-seq
MIRT2122368	hsa-miR-580	CLIP-seq
MIRT2122369	hsa-miR-604	CLIP-seq
MIRT2344614	hsa-miR-608	CLIP-seq
MIRT1408063	hsa-miR-610	CLIP-seq
MIRT1408000	hsa-miR-620	CLIP-seq
MIRT2344615	hsa-miR-625	CLIP-seq
MIRT1408064	hsa-miR-637	CLIP-seq
MIRT2344616	hsa-miR-643	CLIP-seq
MIRT2344617	hsa-miR-644	CLIP-seq
MIRT2122371	hsa-miR-647	CLIP-seq
MIRT2344618	hsa-miR-654-5p	CLIP-seq
MIRT2122372	hsa-miR-661	CLIP-seq
MIRT2344619	hsa-miR-670	CLIP-seq
MIRT2122373	hsa-miR-875-3p	CLIP-seq
MIRT1408068	hsa-miR-920	CLIP-seq
MIRT2122374	hsa-miR-939	CLIP-seq
MIRT2344620	hsa-miR-940	CLIP-seq
MIRT1408020	hsa-miR-3614-5p	CLIP-seq
MIRT1408034	hsa-miR-4418	CLIP-seq
MIRT1408060	hsa-miR-509-3-5p	CLIP-seq
MIRT1408061	hsa-miR-509-5p	CLIP-seq
MIRT2395487	hsa-miR-122	CLIP-seq
MIRT2395488	hsa-miR-1262	CLIP-seq
MIRT1408004	hsa-miR-1276	CLIP-seq
MIRT2395489	hsa-miR-1285	CLIP-seq
MIRT2122333	hsa-miR-134	CLIP-seq
MIRT1408008	hsa-miR-1587	CLIP-seq
MIRT1408011	hsa-miR-2278	CLIP-seq
MIRT1408012	hsa-miR-2467-3p	CLIP-seq
MIRT1408013	hsa-miR-300	CLIP-seq
MIRT2122336	hsa-miR-3118	CLIP-seq
MIRT1408016	hsa-miR-3158-3p	CLIP-seq
MIRT2122338	hsa-miR-3164	CLIP-seq
MIRT2395490	hsa-miR-3187-5p	CLIP-seq
MIRT2122343	hsa-miR-34a	CLIP-seq
MIRT2122344	hsa-miR-34c-5p	CLIP-seq
MIRT1408024	hsa-miR-378g	CLIP-seq
MIRT1408025	hsa-miR-381	CLIP-seq
MIRT2122350	hsa-miR-4254	CLIP-seq
MIRT1408027	hsa-miR-4283	CLIP-seq
MIRT2122353	hsa-miR-4302	CLIP-seq
MIRT1408033	hsa-miR-432	CLIP-seq
MIRT1408034	hsa-miR-4418	CLIP-seq
MIRT1408036	hsa-miR-4443	CLIP-seq
MIRT1407992	hsa-miR-4446-3p	CLIP-seq
MIRT1408038	hsa-miR-4468	CLIP-seq
MIRT1408039	hsa-miR-4489	CLIP-seq
MIRT1408040	hsa-miR-4492	CLIP-seq
MIRT1408041	hsa-miR-4498	CLIP-seq
MIRT2122354	hsa-miR-449a	CLIP-seq
MIRT2122355	hsa-miR-449b	CLIP-seq
MIRT1408042	hsa-miR-4505	CLIP-seq
MIRT1407997	hsa-miR-4656	CLIP-seq
MIRT1408047	hsa-miR-4675	CLIP-seq
MIRT2395491	hsa-miR-4701-3p	CLIP-seq
MIRT1408052	hsa-miR-4731-5p	CLIP-seq
MIRT1408055	hsa-miR-4741	CLIP-seq
MIRT1408058	hsa-miR-485-5p	CLIP-seq
MIRT1408060	hsa-miR-509-3-5p	CLIP-seq
MIRT1408061	hsa-miR-509-5p	CLIP-seq
MIRT2122369	hsa-miR-604	CLIP-seq
MIRT2395492	hsa-miR-612	CLIP-seq
MIRT2122371	hsa-miR-647	CLIP-seq
MIRT1408065	hsa-miR-762	CLIP-seq
MIRT2122337	hsa-miR-3150a-3p	CLIP-seq
MIRT2122339	hsa-miR-3175	CLIP-seq
MIRT1408018	hsa-miR-3188	CLIP-seq
MIRT1408032	hsa-miR-4314	CLIP-seq
MIRT1408046	hsa-miR-4667-5p	CLIP-seq
MIRT2122358	hsa-miR-4683	CLIP-seq
MIRT1408050	hsa-miR-4700-5p	CLIP-seq
MIRT2122362	hsa-miR-4772-5p	CLIP-seq
MIRT2122367	hsa-miR-555	CLIP-seq
MIRT1408064	hsa-miR-637	CLIP-seq
MIRT2122374	hsa-miR-939	CLIP-seq

Show/Hide all (57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000836	Component	Hrd1p ubiquitin ligase complex	IDA	28827405
GO:0000836	Component	Hrd1p ubiquitin ligase complex	TAS	21454652, 23710284
GO:0000839	Component	Hrd1p ubiquitin ligase ERAD-L complex	IDA	28827405
GO:0000839	Component	Hrd1p ubiquitin ligase ERAD-L complex	IMP	26471130
GO:0002327	Process	Immature B cell differentiation	ISS
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IDA	16286920
GO:0005515	Function	Protein binding	IPI	17170702, 18264092, 18369366, 18502753, 19135427, 19690564, 21343306, 21949850, 22119785, 24068323, 26471130, 26551274, 28827405, 31477895, 33961781, 35271311, 37943610
GO:0005654	Component	Nucleoplasm	IDA
GO:0005783	Component	Endoplasmic reticulum	IDA	37795761
GO:0005783	Component	Endoplasmic reticulum	IDA	12459480, 14593114, 17059562
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	23710284
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	14593114
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005790	Component	Smooth endoplasmic reticulum	IDA	16186510
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	14593114, 17059562
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	23710284
GO:0008270	Function	Zinc ion binding	IEA
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IDA	12459480, 22590560
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	TAS	23710284
GO:0016740	Function	Transferase activity	IEA
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IMP	25660456
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	IDA	12459480, 14593114, 17059562, 22590560
GO:0036503	Process	ERAD pathway	IMP	21245296
GO:0036503	Process	ERAD pathway	IMP	22607976, 26471130, 28827405
GO:0036503	Process	ERAD pathway	TAS	22013210, 23710284
GO:0036513	Component	Derlin-1 retrotranslocation complex	IDA	21454652
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IBA
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IDA	23233672, 24478453
GO:0044322	Component	Endoplasmic reticulum quality control compartment	IEA
GO:0044322	Component	Endoplasmic reticulum quality control compartment	TAS	21062743
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	IMP	21454652
GO:0051082	Function	Unfolded protein binding	IPI	17059562
GO:0051087	Function	Protein-folding chaperone binding	IPI	21636303
GO:0051117	Function	ATPase binding	IPI	16186510, 22590560
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	12459480, 14593114, 17059562, 19103148
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	21245296, 28842558
GO:0061630	Function	Ubiquitin protein ligase activity	NAS	22590560
GO:0061630	Function	Ubiquitin protein ligase activity	TAS	21062743, 23710284
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	14593114
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	12459480, 17059562
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	TAS	23710284
GO:1904380	Process	Endoplasmic reticulum mannose trimming	TAS
GO:1990381	Function	Ubiquitin-specific protease binding	IPI	22590560, 24068323

MIM	HGNC	e!Ensembl
608046	20738	ENSG00000162298

Q86TM6

Protein name

E3 ubiquitin-protein ligase synoviolin (EC 2.3.2.27) (RING-type E3 ubiquitin transferase synoviolin) (Synovial apoptosis inhibitor 1)

Protein function

E3 ubiquitin-protein ligase which accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation (PubMed:12459480, PubMed:12646171, PubMed:12975321, PubMed:14593114

PDB

6A3Z , 8KES , 8KET , 8KEV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13639	zf-RING_2	289 → 330	Ring finger domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in liver and kidney (at protein level). Up-regulated in synovial tissues from patients with rheumatoid arthritis (at protein level). {ECO:0000269|PubMed:12459480, ECO:0000269|PubMed:12646171,

Sequence

MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKV
MGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLA
EDRVDFMERSPNISWLFHCRIVSLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAI
LMTMVLTIFIKYVLHSVDLQSENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTF
PLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVT
GAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGPPPAPHPP
PLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAAALSRPSGA
ATTTAAGTSATAASATASGPGSGSAPEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAG
FAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSV
NSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDA
AELRRRRLQKLESPVAH

Sequence length

617

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis Protein processing in endoplasmic reticulum		XBP1(S) activates chaperone genes Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD ER Quality Control Compartment (ERQC)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOSPADIAS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (66)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	20471517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20606367	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12975321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21987572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	12975321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32308114	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28770435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27417417, 30306751		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	1913607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28423597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35048790, 35543347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37099251	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32754264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19282840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	25385046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	1913607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	30306751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30306455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of face	Facial dysmorphism	BEFREE	17257873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	15796966, 8402545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28260078, 30167107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15464997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15464997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27082896, 29233968		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	3585938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	30843874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30201971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	11150606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kenny-Caffey syndrome	Kenny-Caffey Syndrome	BEFREE	17257873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29958993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	24636985, 29916549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37075843	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28842558, 9398863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28423597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	3422215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11691785, 30306455, 30504895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30306455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30201971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27417417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	24565866		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	2065307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	30306751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30106139, 30306455, 8646734, 9585616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30361093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30475171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30504895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25698262, 29916549, 30201971, 30365055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32066502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	36193504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21892618, 30361093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37632637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28091582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	19282840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	19282840, 21221615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	3422215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11284032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	24114659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12975321, 29039504, 29916549, 30306455, 30365055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16786162, 16802346, 18235538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoglycanopathies	Sarcoglycanopathies	Pubtator	24565866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29916549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19282840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30201971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	9585616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram Syndrome	BEFREE	20160352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome 1	Wolfram Syndrome	BEFREE	20160352		★★★★★ ★☆☆☆☆ Found in Text Mining only

SYVN1 (synoviolin 1)