Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84445
Gene name	Leucine zipper tumor suppressor 2
Gene symbol	LZTS2
Synonyms (NCBI Gene)	LAPSER1
Chromosome	10
Chromosome location	10q24.31
Summary	The protein encoded by this gene belongs to the leucine zipper tumor suppressor family of proteins, which function in transcription regulation and cell cycle control. This family member can repress beta-catenin-mediated transcriptional activation and is a

113

Show/Hide all (113)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017535	hsa-miR-335-5p	Microarray	18185580
MIRT1124530	hsa-miR-1203	CLIP-seq
MIRT1124531	hsa-miR-1207-3p	CLIP-seq
MIRT1124532	hsa-miR-1262	CLIP-seq
MIRT1124533	hsa-miR-138	CLIP-seq
MIRT1124534	hsa-miR-149	CLIP-seq
MIRT1124535	hsa-miR-1587	CLIP-seq
MIRT1124536	hsa-miR-299-3p	CLIP-seq
MIRT1124537	hsa-miR-300	CLIP-seq
MIRT1124538	hsa-miR-3064-5p	CLIP-seq
MIRT1124539	hsa-miR-3119	CLIP-seq
MIRT1124540	hsa-miR-3126-3p	CLIP-seq
MIRT1124541	hsa-miR-3160-5p	CLIP-seq
MIRT1124542	hsa-miR-3170	CLIP-seq
MIRT1124543	hsa-miR-3179	CLIP-seq
MIRT1124544	hsa-miR-326	CLIP-seq
MIRT1124545	hsa-miR-330-5p	CLIP-seq
MIRT1124546	hsa-miR-3613-3p	CLIP-seq
MIRT1124547	hsa-miR-3652	CLIP-seq
MIRT1124548	hsa-miR-381	CLIP-seq
MIRT1124549	hsa-miR-3940-5p	CLIP-seq
MIRT1124550	hsa-miR-4260	CLIP-seq
MIRT1124551	hsa-miR-4265	CLIP-seq
MIRT1124552	hsa-miR-4269	CLIP-seq
MIRT1124553	hsa-miR-4282	CLIP-seq
MIRT1124554	hsa-miR-4296	CLIP-seq
MIRT1124555	hsa-miR-4302	CLIP-seq
MIRT1124556	hsa-miR-4322	CLIP-seq
MIRT1124557	hsa-miR-4417	CLIP-seq
MIRT1124558	hsa-miR-4430	CLIP-seq
MIRT1124559	hsa-miR-4492	CLIP-seq
MIRT1124560	hsa-miR-4498	CLIP-seq
MIRT1124561	hsa-miR-4507	CLIP-seq
MIRT1124562	hsa-miR-4656	CLIP-seq
MIRT1124563	hsa-miR-4666-3p	CLIP-seq
MIRT1124564	hsa-miR-4675	CLIP-seq
MIRT1124565	hsa-miR-4701-3p	CLIP-seq
MIRT1124566	hsa-miR-4719	CLIP-seq
MIRT1124567	hsa-miR-4741	CLIP-seq
MIRT1124568	hsa-miR-4768-5p	CLIP-seq
MIRT1124569	hsa-miR-4775	CLIP-seq
MIRT1124570	hsa-miR-4794	CLIP-seq
MIRT1124571	hsa-miR-485-5p	CLIP-seq
MIRT1124572	hsa-miR-490-3p	CLIP-seq
MIRT1124573	hsa-miR-548ad	CLIP-seq
MIRT1124574	hsa-miR-548q	CLIP-seq
MIRT1124575	hsa-miR-570	CLIP-seq
MIRT1124576	hsa-miR-582-5p	CLIP-seq
MIRT1124577	hsa-miR-590-3p	CLIP-seq
MIRT1124578	hsa-miR-615-5p	CLIP-seq
MIRT1124579	hsa-miR-629	CLIP-seq
MIRT1124580	hsa-miR-646	CLIP-seq
MIRT1124581	hsa-miR-671-5p	CLIP-seq
MIRT1124582	hsa-miR-762	CLIP-seq
MIRT1124583	hsa-miR-9	CLIP-seq
MIRT1124530	hsa-miR-1203	CLIP-seq
MIRT2035198	hsa-miR-132	CLIP-seq
MIRT1124534	hsa-miR-149	CLIP-seq
MIRT2035199	hsa-miR-194	CLIP-seq
MIRT2035200	hsa-miR-2110	CLIP-seq
MIRT2035201	hsa-miR-212	CLIP-seq
MIRT1124536	hsa-miR-299-3p	CLIP-seq
MIRT1124538	hsa-miR-3064-5p	CLIP-seq
MIRT2035202	hsa-miR-3132	CLIP-seq
MIRT2035203	hsa-miR-3144-5p	CLIP-seq
MIRT1124544	hsa-miR-326	CLIP-seq
MIRT1124545	hsa-miR-330-5p	CLIP-seq
MIRT2035204	hsa-miR-335	CLIP-seq
MIRT2035205	hsa-miR-3616-5p	CLIP-seq
MIRT2035206	hsa-miR-3647-5p	CLIP-seq
MIRT2035207	hsa-miR-3649	CLIP-seq
MIRT1124551	hsa-miR-4265	CLIP-seq
MIRT1124552	hsa-miR-4269	CLIP-seq
MIRT2035208	hsa-miR-4271	CLIP-seq
MIRT1124554	hsa-miR-4296	CLIP-seq
MIRT1124556	hsa-miR-4322	CLIP-seq
MIRT1124557	hsa-miR-4417	CLIP-seq
MIRT2035209	hsa-miR-4682	CLIP-seq
MIRT1124566	hsa-miR-4719	CLIP-seq
MIRT2035210	hsa-miR-4725-3p	CLIP-seq
MIRT1124570	hsa-miR-4794	CLIP-seq
MIRT2035211	hsa-miR-4795-5p	CLIP-seq
MIRT2035212	hsa-miR-491-5p	CLIP-seq
MIRT2035213	hsa-miR-555	CLIP-seq
MIRT2035214	hsa-miR-573	CLIP-seq
MIRT2035215	hsa-miR-602	CLIP-seq
MIRT2035216	hsa-miR-802	CLIP-seq
MIRT2035217	hsa-miR-885-3p	CLIP-seq
MIRT2035198	hsa-miR-132	CLIP-seq
MIRT1124534	hsa-miR-149	CLIP-seq
MIRT2035199	hsa-miR-194	CLIP-seq
MIRT2035200	hsa-miR-2110	CLIP-seq
MIRT2035201	hsa-miR-212	CLIP-seq
MIRT1124538	hsa-miR-3064-5p	CLIP-seq
MIRT2035202	hsa-miR-3132	CLIP-seq
MIRT2035203	hsa-miR-3144-5p	CLIP-seq
MIRT1124544	hsa-miR-326	CLIP-seq
MIRT1124545	hsa-miR-330-5p	CLIP-seq
MIRT2035204	hsa-miR-335	CLIP-seq
MIRT2035205	hsa-miR-3616-5p	CLIP-seq
MIRT2035206	hsa-miR-3647-5p	CLIP-seq
MIRT2035207	hsa-miR-3649	CLIP-seq
MIRT2035208	hsa-miR-4271	CLIP-seq
MIRT2035210	hsa-miR-4725-3p	CLIP-seq
MIRT1124570	hsa-miR-4794	CLIP-seq
MIRT2035211	hsa-miR-4795-5p	CLIP-seq
MIRT1124571	hsa-miR-485-5p	CLIP-seq
MIRT2035212	hsa-miR-491-5p	CLIP-seq
MIRT2035213	hsa-miR-555	CLIP-seq
MIRT2035214	hsa-miR-573	CLIP-seq
MIRT2035215	hsa-miR-602	CLIP-seq
MIRT2035216	hsa-miR-802	CLIP-seq
MIRT2035217	hsa-miR-885-3p	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000281	Process	Mitotic cytokinesis	IEA
GO:0001822	Process	Kidney development	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 22458338, 23602568, 24722188, 25416956, 25910212, 26871637, 26949739, 27956147, 28514442, 31515488, 31980649, 32296183, 32707033, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030496	Component	Midbody	IEA
GO:0031982	Component	Vesicle	IDA	25468996
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0051013	Process	Microtubule severing	IEA
GO:0051168	Process	Nuclear export	IEA
GO:0051255	Process	Spindle midzone assembly	IEA
GO:0051301	Process	Cell division	IEA
GO:0060682	Process	Primary ureteric bud growth	IEA
GO:0072197	Process	Ureter morphogenesis	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA

MIM	HGNC	e!Ensembl
610454	29381	ENSG00000107816

Q9BRK4

Protein name

Leucine zipper putative tumor suppressor 2 (hLZTS2) (Protein LAPSER1)

Protein function

Negative regulator of katanin-mediated microtubule severing and release from the centrosome. Required for central spindle formation and the completion of cytokinesis. May negatively regulate axonal outgrowth by preventing the formation of microt

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06818	Fez1	439 → 636		Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in prostate and testis, and at slightly lower levels in spleen, thymus, uterus, small intestine and colon. {ECO:0000269|PubMed:11709705}.

Sequence

MAIVQTLPVPLEPAPEAATAPQAPVMGSVSSLISGRPCPGGPAPPRHHGPPGPTFFRQQD
GLLRGGYEAQEPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL
RGPPPKLIPVSGKLEKNMEKILIRPTAFKPVLPKPRGAPSLPSFMGPRATGLSGSQGSLT
QLFGGPASSSSSSSSSSAADKPLAFSGWASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTT
SSPGGHLPSHGSGRGALPGPARGVPTGPSHSDSGRSSSSKSTGSLGGRVAGGLLGSGTRA
SPDSSSCGERSPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSLDENEATMCQAYEE
RQRHWQREREALREDCAAQAQRAQRAQQLLQLQVFQLQQEKRQLQDDFAQLLQEREQLER
RCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKGSELVALRVALRE
ARATLRVSEGRARGLQEAARARELELEACSQELQRHRQEAEQLREKAGQLDAEAAGLREP
PVPPATADPFLLAESDEAKVQRAAAGVGGSLRAQVERLRVELQRERRRGEEQRDSFEGER
LAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLEQELQQLSLELEARELADLGLAEQAPCIC
LEEITATEI

Sequence length

669

Interactions

View interactions

	KEGG
	Wnt signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	18242184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29499699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28323888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23275340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23761130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36750557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18242184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29499699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28222251, 35148810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23761130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29499699	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23761130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17351128, 23275340, 28323888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11709705, 17351128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29409973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11709705, 17000760, 17351128, 23275340, 23761130, 24464870, 28323888, 29499699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23761130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17351128, 23275340, 28323888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11709705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29499699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LZTS2 (leucine zipper tumor suppressor 2)