Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	8444
Gene name	Dual specificity tyrosine phosphorylation regulated kinase 3
Gene symbol	DYRK3
Synonyms (NCBI Gene)	DYRK5REDREDKhYAK3-2
Chromosome	1
Chromosome location	1q32.1
Summary	This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specif

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029437	hsa-miR-26b-5p	Microarray	19088304
MIRT710186	hsa-miR-3646	HITS-CLIP	19536157
MIRT710185	hsa-miR-1252-3p	HITS-CLIP	19536157
MIRT710184	hsa-miR-4318	HITS-CLIP	19536157
MIRT710183	hsa-miR-7114-5p	HITS-CLIP	19536157
MIRT710182	hsa-miR-4252	HITS-CLIP	19536157
MIRT710181	hsa-miR-3138	HITS-CLIP	19536157
MIRT710180	hsa-miR-4800-5p	HITS-CLIP	19536157
MIRT710186	hsa-miR-3646	HITS-CLIP	19536157
MIRT710185	hsa-miR-1252-3p	HITS-CLIP	19536157
MIRT710184	hsa-miR-4318	HITS-CLIP	19536157
MIRT710183	hsa-miR-7114-5p	HITS-CLIP	19536157
MIRT710182	hsa-miR-4252	HITS-CLIP	19536157
MIRT710181	hsa-miR-3138	HITS-CLIP	19536157
MIRT710180	hsa-miR-4800-5p	HITS-CLIP	19536157
MIRT477853	hsa-miR-3133	PAR-CLIP	23592263
MIRT477852	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT477851	hsa-miR-3714	PAR-CLIP	23592263
MIRT477850	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT477849	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT477848	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT477847	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT477846	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT477845	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT477844	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT477843	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT477842	hsa-miR-2392	PAR-CLIP	23592263
MIRT477841	hsa-miR-648	PAR-CLIP	23592263
MIRT477840	hsa-miR-556-5p	PAR-CLIP	23592263
MIRT477839	hsa-miR-4310	PAR-CLIP	23592263
MIRT477838	hsa-miR-7157-5p	PAR-CLIP	23592263
MIRT477837	hsa-miR-4780	PAR-CLIP	23592263
MIRT477836	hsa-miR-6780b-3p	PAR-CLIP	23592263
MIRT477835	hsa-miR-4287	PAR-CLIP	23592263
MIRT477834	hsa-miR-4685-3p	PAR-CLIP	23592263
MIRT477833	hsa-miR-4635	PAR-CLIP	23592263
MIRT477832	hsa-miR-3185	PAR-CLIP	23592263
MIRT477831	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT477830	hsa-miR-4468	PAR-CLIP	23592263
MIRT477829	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT477828	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT477827	hsa-miR-34a-5p	PAR-CLIP	23592263
MIRT477826	hsa-miR-34c-5p	PAR-CLIP	23592263
MIRT477825	hsa-miR-449a	PAR-CLIP	23592263
MIRT477824	hsa-miR-449b-5p	PAR-CLIP	23592263
MIRT477823	hsa-miR-4504	PAR-CLIP	23592263
MIRT477822	hsa-miR-542-3p	PAR-CLIP	23592263
MIRT477821	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT477820	hsa-miR-623	PAR-CLIP	23592263
MIRT477819	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT477818	hsa-miR-489-3p	PAR-CLIP	23592263
MIRT477817	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT477816	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT477815	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT477814	hsa-miR-5680	PAR-CLIP	23592263
MIRT477813	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT477812	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT477811	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT477810	hsa-miR-936	PAR-CLIP	23592263
MIRT477809	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT477808	hsa-miR-548v	PAR-CLIP	23592263
MIRT477807	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT477806	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT477805	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT477804	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT710186	hsa-miR-3646	HITS-CLIP	19536157
MIRT710185	hsa-miR-1252-3p	HITS-CLIP	19536157
MIRT710184	hsa-miR-4318	HITS-CLIP	19536157
MIRT710183	hsa-miR-7114-5p	HITS-CLIP	19536157
MIRT710182	hsa-miR-4252	HITS-CLIP	19536157
MIRT710181	hsa-miR-3138	HITS-CLIP	19536157
MIRT710180	hsa-miR-4800-5p	HITS-CLIP	19536157
MIRT477853	hsa-miR-3133	PAR-CLIP	23592263
MIRT477852	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT477851	hsa-miR-3714	PAR-CLIP	23592263
MIRT477850	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT477849	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT477848	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT477847	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT477846	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT477845	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT477844	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT477843	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT477842	hsa-miR-2392	PAR-CLIP	23592263
MIRT477841	hsa-miR-648	PAR-CLIP	23592263
MIRT477840	hsa-miR-556-5p	PAR-CLIP	23592263
MIRT477839	hsa-miR-4310	PAR-CLIP	23592263
MIRT477838	hsa-miR-7157-5p	PAR-CLIP	23592263
MIRT477837	hsa-miR-4780	PAR-CLIP	23592263
MIRT477836	hsa-miR-6780b-3p	PAR-CLIP	23592263
MIRT477835	hsa-miR-4287	PAR-CLIP	23592263
MIRT477834	hsa-miR-4685-3p	PAR-CLIP	23592263
MIRT477833	hsa-miR-4635	PAR-CLIP	23592263
MIRT477832	hsa-miR-3185	PAR-CLIP	23592263
MIRT477831	hsa-miR-605-3p	PAR-CLIP	23592263
MIRT477830	hsa-miR-4468	PAR-CLIP	23592263
MIRT477829	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT477828	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT477827	hsa-miR-34a-5p	PAR-CLIP	23592263
MIRT477826	hsa-miR-34c-5p	PAR-CLIP	23592263
MIRT477825	hsa-miR-449a	PAR-CLIP	23592263
MIRT477824	hsa-miR-449b-5p	PAR-CLIP	23592263
MIRT477823	hsa-miR-4504	PAR-CLIP	23592263
MIRT477822	hsa-miR-542-3p	PAR-CLIP	23592263
MIRT477821	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT477820	hsa-miR-623	PAR-CLIP	23592263
MIRT477819	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT477818	hsa-miR-489-3p	PAR-CLIP	23592263
MIRT477817	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT477816	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT477815	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT477814	hsa-miR-5680	PAR-CLIP	23592263
MIRT477813	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT477812	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT477811	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT477810	hsa-miR-936	PAR-CLIP	23592263
MIRT477809	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT477808	hsa-miR-548v	PAR-CLIP	23592263
MIRT477807	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT477806	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT477805	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT477804	hsa-miR-203a-3p	PAR-CLIP	23592263

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000242	Component	Pericentriolar material	IDA	29973724
GO:0000287	Function	Magnesium ion binding	IDA	10779429
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004672	Function	Protein kinase activity	IDA	10779429
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	9748265
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	29634919, 29973724
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	23415227
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IDA	10779429
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10779429, 20167603
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23415227
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10779429, 29634919, 29973724
GO:0006468	Process	Protein phosphorylation	TAS	9748265
GO:0010494	Component	Cytoplasmic stress granule	IDA	23415227, 29973724
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA	29973724
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030218	Process	Erythrocyte differentiation	IDA	10779429
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0035063	Process	Nuclear speck organization	IDA	29973724
GO:0035617	Process	Stress granule disassembly	IBA
GO:0035617	Process	Stress granule disassembly	IDA	29973724
GO:0035617	Process	Stress granule disassembly	IMP	23415227
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0080135	Process	Regulation of cellular response to stress	IMP	23415227
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902751	Process	Positive regulation of cell cycle G2/M phase transition	IBA
GO:1902751	Process	Positive regulation of cell cycle G2/M phase transition	IDA	29973724
GO:1903008	Process	Organelle disassembly	IDA	29973724
GO:1903432	Process	Regulation of TORC1 signaling	IMP	23415227

MIM	HGNC	e!Ensembl
603497	3094	ENSG00000143479

O43781

Protein name

Dual specificity tyrosine-phosphorylation-regulated kinase 3 (EC 2.7.12.1) (Regulatory erythroid kinase) (REDK)

Protein function

Dual-specificity protein kinase that promotes disassembly of several types of membraneless organelles during mitosis, such as stress granules, nuclear speckles and pericentriolar material (PubMed:29973724). Dual-specificity tyrosine-regulated ki

PDB

5Y86

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	209 → 522	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1: Highly expressed in testis and in hematopoietic tissue such as fetal liver, and bone marrow (PubMed:10779429). Isoform 1: Predominant form in fetal liver and bone marrow (PubMed:10779429). Isoform 1: Present at low levels in

Sequence

MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPR
RLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
SDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHG
VIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
KNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGS
KDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKR
VVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS

Sequence length

588

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia	Anemia	BEFREE	29634919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	31684854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24376576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Color blindness	Color Blindness	BEFREE	12626747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniofacial Dysostosis	Craniofacial Dysostosis	BEFREE	30642732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniofacial dysostosis type 1	Craniofacial Dysostosis	BEFREE	30642732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28611698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	31684854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Autosomal Dominant Spastic Paraplegia	Spastic paraplegia	BEFREE	10493830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31066068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29090347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15746946, 27565211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38139175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31337415		★★★★★ ★☆☆☆☆ Found in Text Mining only

DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3)