ADGRA1 (adhesion G protein-coupled receptor A1)

Gene

• Entrez ID: 84435
• Gene name: Adhesion G protein-coupled receptor A1
• Gene symbol: ADGRA1
• Synonyms (NCBI Gene): GPR123
• Chromosome: 10
• Chromosome location: 10q26.3
• Summary: This gene encodes a protein that belongs to the adhesion family of G-protein-coupled receptors. Members of this family function in several sensory systems and regulate blood pressure, immune responses, food intake and development. A similar protein in rod

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT755202	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT755203	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT755204	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT755205	hsa-miR-1253	PAR-CLIP	23592263
MIRT755206	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT755207	hsa-miR-1827	PAR-CLIP	23592263
MIRT755208	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT755209	hsa-miR-3665	PAR-CLIP	23592263
MIRT755210	hsa-miR-6828-5p	PAR-CLIP	23592263
MIRT755211	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT755212	hsa-miR-4710	PAR-CLIP	23592263
MIRT755213	hsa-miR-4316	PAR-CLIP	23592263
MIRT755214	hsa-miR-6079	PAR-CLIP	23592263

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	NAS	12565841, 17212699
GO:0004930	Function	G protein-coupled receptor activity	TAS	15203201
GO:0005886	Component	Plasma membrane	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	NAS	17212699
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15203201
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	12565841, 17212699
GO:0016020	Component	Membrane	TAS	15203201
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 612302
• HGNC: 13838
• e!Ensembl: ENSG00000197177

Protein

• UniProt ID: Q86SQ6
• Protein name: Adhesion G protein-coupled receptor A1 (G-protein coupled receptor 123)
• Protein function: Orphan receptor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00002	7tm_2	16 → 302	7 transmembrane receptor (Secretin family)	Family

• Sequence:

  MDLKTVLSLPRYPGEFLHPVVYACTAVMLLCLLASFVTYIVHQSAIRISRKGRHTLLNFC
  FHAALTFTVFAGGINRTKYPILCQAVGIVLHYSTLSTMLWIGVTARNIYKQVTKKAPLCL
  DTDQPPYPRQPLLRFYLVSGGVPFIICGVTAATNIRNYGTEDEDTAYCWMAWEPSLGAFY
  GPAAIITLVTCVYFLGTYVQLRRHPGRRYELRTQPEEQRRLATPEGGRGIRPGTPPAHDA
  PGASVLQNEHSFQAQLRAAAFTLFLFTATWAFGALAVSQGHFLDMVFSCLYGAFCVTLGL
  FVLIHHCAKREDVWQCWWACCPPRKDAHPALDANGAALGRAACLHSPGLGQPRGFAHPPG
  PCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGR
  TKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPM
  VTQPEGSDGSPALYSCPTQPGREAALGPGHLEMLRRTQSLPFGGPSQNGLPKGKLLEGLP
  FGTDGTGNIRTGPWKNETTV

• Sequence length: 560

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	BEFREE	18682798		★☆☆☆☆ Found in Text Mining only