PROK1 (prokineticin 1)

Gene

• Entrez ID: 84432
• Gene name: Prokineticin 1
• Gene symbol: PROK1
• Synonyms (NCBI Gene): EGVEGF, PK1, PRK1
• Chromosome: 1
• Chromosome location: 1p13.3
• Summary: The protein encoded by this gene induces proliferation, migration, and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It has little or no effect on a variety of other endothelial and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1265048	hsa-miR-3162-3p	CLIP-seq
MIRT1265049	hsa-miR-3179	CLIP-seq
MIRT1265050	hsa-miR-378g	CLIP-seq
MIRT1265051	hsa-miR-4292	CLIP-seq
MIRT1265052	hsa-miR-4308	CLIP-seq
MIRT1265053	hsa-miR-4437	CLIP-seq
MIRT1265054	hsa-miR-4674	CLIP-seq
MIRT1265055	hsa-miR-4757-5p	CLIP-seq
MIRT1265056	hsa-miR-509-3p	CLIP-seq
MIRT2077915	hsa-miR-3127-5p	CLIP-seq
MIRT2077916	hsa-miR-4656	CLIP-seq
MIRT1265056	hsa-miR-509-3p	CLIP-seq
MIRT2077917	hsa-miR-924	CLIP-seq
MIRT2077915	hsa-miR-3127-5p	CLIP-seq
MIRT2304445	hsa-miR-3664-3p	CLIP-seq
MIRT2077916	hsa-miR-4656	CLIP-seq
MIRT2393047	hsa-miR-1228	CLIP-seq
MIRT2393048	hsa-miR-377	CLIP-seq
MIRT2393049	hsa-miR-4701-5p	CLIP-seq
MIRT2393050	hsa-miR-588	CLIP-seq
MIRT2457217	hsa-miR-1224-3p	CLIP-seq
MIRT2457218	hsa-miR-1260	CLIP-seq
MIRT2457219	hsa-miR-1260b	CLIP-seq
MIRT2457220	hsa-miR-1280	CLIP-seq
MIRT2457221	hsa-miR-378	CLIP-seq
MIRT2457222	hsa-miR-378b	CLIP-seq
MIRT2457223	hsa-miR-378c	CLIP-seq
MIRT2457224	hsa-miR-378d	CLIP-seq
MIRT2457225	hsa-miR-378e	CLIP-seq
MIRT2457226	hsa-miR-378f	CLIP-seq
MIRT2457227	hsa-miR-378h	CLIP-seq
MIRT2457228	hsa-miR-378i	CLIP-seq
MIRT2457229	hsa-miR-422a	CLIP-seq
MIRT2457230	hsa-miR-4520a-3p	CLIP-seq
MIRT2457231	hsa-miR-4638-3p	CLIP-seq
MIRT2457232	hsa-miR-532-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001935	Process	Endothelial cell proliferation	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0101023	Process	Vascular endothelial cell proliferation	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IEA

Other IDs

• MIM: 606233
• HGNC: 18454
• e!Ensembl: ENSG00000143125

Protein

• UniProt ID: P58294
• Protein name: Prokineticin-1 (Endocrine-gland-derived vascular endothelial growth factor) (EG-VEGF) (Mambakine)
• Protein function: Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a vari
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06607	Prokineticin	1 → 97	Prokineticin	Family

• Tissue specificity: TISSUE SPECIFICITY: Localizes to glandular epithelium, stroma and vascular epithelial cells of first trimester decidua (at protein level). Up-regulated in first trimester decidua when compared with non-pregnant endometrium. Expressed in the steroidogenic
• Sequence:

  MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEEC
  HPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF

• Sequence length: 105

Pathways

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	19427017		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	26475302		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	26475302	Associate	★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	16263331		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	16263331		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	35983033	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19427017		★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	24496457	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22990536	Associate	★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	29226856		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	28899975		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23135359		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17786959, 29226856		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26318037, 29226856, 34657605	Associate	★☆☆☆☆ Found in Text Mining only
Complete hydatidiform mole	Complete Hydatidiform Mole	BEFREE	28899975		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	26047640	Stimulate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	28782224		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16210375		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	16210375		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19285664, 20400074		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19285664, 20400074, 37662927	Associate	★☆☆☆☆ Found in Text Mining only
Euthyroid multinodular goiter	Euthyroid multinodular goiter	BEFREE	21385081		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35845958	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	21385081		★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	26318037	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	21858136, 22648184		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	21858136	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28782224		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28782224	Associate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	34782535	Associate	★☆☆☆☆ Found in Text Mining only
Leydig Cell Tumor	Leydig Cell Tumor	LHGDN	15292351		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17167981		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17167981		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16210375		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30551529		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12514133, 16763065, 19427017, 25504435, 26296974		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21385081		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16763065, 19427017, 25504435		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23135359		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	19427017		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	25504435		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	25064403		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20795791		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15026321, 21385081, 26475302, 28899975, 29226856, 30551529		★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	36233195	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	28820403		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22990536	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	19427017		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30551529		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30551529, 35146962	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21385081		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	29226856	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	30838843	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	12759245, 14984768, 31322191		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	12759245	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12514133, 16763065, 19427017, 25504435, 26296974		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12514133		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21385081		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21385081		★☆☆☆☆ Found in Text Mining only