Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84342
Gene name	Component of oligomeric golgi complex 8
Gene symbol	COG8
Synonyms (NCBI Gene)	CDG2HDOR1
Chromosome	16
Chromosome location	16q22.1
Summary	This gene encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modificatio

Show/Hide all (5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs72795277	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Synonymous variant, coding sequence variant
rs113642086	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Synonymous variant, coding sequence variant
rs779899559	G>A,C	Likely-pathogenic	Coding sequence variant, stop gained, missense variant
rs890271209	A>C,G	Likely-pathogenic	Missense variant, stop gained, coding sequence variant
rs1597225261	C>A	Likely-pathogenic	Splice donor variant

154

Show/Hide all (154)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045035	hsa-miR-186-5p	CLASH	23622248
MIRT902324	hsa-miR-145	CLIP-seq
MIRT902325	hsa-miR-182	CLIP-seq
MIRT902326	hsa-miR-187	CLIP-seq
MIRT902327	hsa-miR-2110	CLIP-seq
MIRT902328	hsa-miR-217	CLIP-seq
MIRT902329	hsa-miR-2355-3p	CLIP-seq
MIRT902330	hsa-miR-3074-5p	CLIP-seq
MIRT902331	hsa-miR-3119	CLIP-seq
MIRT902332	hsa-miR-3122	CLIP-seq
MIRT902333	hsa-miR-3127-5p	CLIP-seq
MIRT902334	hsa-miR-3144-5p	CLIP-seq
MIRT902335	hsa-miR-3150a-3p	CLIP-seq
MIRT902336	hsa-miR-3158-5p	CLIP-seq
MIRT902337	hsa-miR-3166	CLIP-seq
MIRT902338	hsa-miR-3191	CLIP-seq
MIRT902339	hsa-miR-323-3p	CLIP-seq
MIRT902340	hsa-miR-3609	CLIP-seq
MIRT902341	hsa-miR-3618	CLIP-seq
MIRT902342	hsa-miR-3689a-3p	CLIP-seq
MIRT902343	hsa-miR-3689c	CLIP-seq
MIRT902344	hsa-miR-3691-3p	CLIP-seq
MIRT902345	hsa-miR-3713	CLIP-seq
MIRT902346	hsa-miR-382	CLIP-seq
MIRT902347	hsa-miR-3913-5p	CLIP-seq
MIRT902348	hsa-miR-3918	CLIP-seq
MIRT902349	hsa-miR-3928	CLIP-seq
MIRT902350	hsa-miR-3973	CLIP-seq
MIRT902351	hsa-miR-4267	CLIP-seq
MIRT902352	hsa-miR-4312	CLIP-seq
MIRT902353	hsa-miR-4323	CLIP-seq
MIRT902354	hsa-miR-4418	CLIP-seq
MIRT902355	hsa-miR-4470	CLIP-seq
MIRT902356	hsa-miR-4480	CLIP-seq
MIRT902357	hsa-miR-4636	CLIP-seq
MIRT902358	hsa-miR-4646-3p	CLIP-seq
MIRT902359	hsa-miR-4652-5p	CLIP-seq
MIRT902360	hsa-miR-4659a-5p	CLIP-seq
MIRT902361	hsa-miR-4659b-5p	CLIP-seq
MIRT902362	hsa-miR-4662a-5p	CLIP-seq
MIRT902363	hsa-miR-4690-3p	CLIP-seq
MIRT902364	hsa-miR-4771	CLIP-seq
MIRT902365	hsa-miR-4789-5p	CLIP-seq
MIRT902366	hsa-miR-509-3-5p	CLIP-seq
MIRT902367	hsa-miR-509-5p	CLIP-seq
MIRT902368	hsa-miR-520g	CLIP-seq
MIRT902369	hsa-miR-520h	CLIP-seq
MIRT902370	hsa-miR-532-5p	CLIP-seq
MIRT902371	hsa-miR-548ah	CLIP-seq
MIRT902372	hsa-miR-548p	CLIP-seq
MIRT902373	hsa-miR-552	CLIP-seq
MIRT902374	hsa-miR-556-3p	CLIP-seq
MIRT902375	hsa-miR-934	CLIP-seq
MIRT902324	hsa-miR-145	CLIP-seq
MIRT902326	hsa-miR-187	CLIP-seq
MIRT902327	hsa-miR-2110	CLIP-seq
MIRT902328	hsa-miR-217	CLIP-seq
MIRT1967670	hsa-miR-219-2-3p	CLIP-seq
MIRT902329	hsa-miR-2355-3p	CLIP-seq
MIRT902330	hsa-miR-3074-5p	CLIP-seq
MIRT902331	hsa-miR-3119	CLIP-seq
MIRT902332	hsa-miR-3122	CLIP-seq
MIRT902333	hsa-miR-3127-5p	CLIP-seq
MIRT902334	hsa-miR-3144-5p	CLIP-seq
MIRT902335	hsa-miR-3150a-3p	CLIP-seq
MIRT902336	hsa-miR-3158-5p	CLIP-seq
MIRT902337	hsa-miR-3166	CLIP-seq
MIRT902338	hsa-miR-3191	CLIP-seq
MIRT902339	hsa-miR-323-3p	CLIP-seq
MIRT902340	hsa-miR-3609	CLIP-seq
MIRT902341	hsa-miR-3618	CLIP-seq
MIRT1967671	hsa-miR-3660	CLIP-seq
MIRT902342	hsa-miR-3689a-3p	CLIP-seq
MIRT902343	hsa-miR-3689c	CLIP-seq
MIRT902344	hsa-miR-3691-3p	CLIP-seq
MIRT902345	hsa-miR-3713	CLIP-seq
MIRT902346	hsa-miR-382	CLIP-seq
MIRT1967672	hsa-miR-3913-3p	CLIP-seq
MIRT902347	hsa-miR-3913-5p	CLIP-seq
MIRT902348	hsa-miR-3918	CLIP-seq
MIRT902349	hsa-miR-3928	CLIP-seq
MIRT902350	hsa-miR-3973	CLIP-seq
MIRT1967673	hsa-miR-4256	CLIP-seq
MIRT1967674	hsa-miR-4260	CLIP-seq
MIRT902351	hsa-miR-4267	CLIP-seq
MIRT1967675	hsa-miR-4275	CLIP-seq
MIRT902353	hsa-miR-4323	CLIP-seq
MIRT902354	hsa-miR-4418	CLIP-seq
MIRT1967676	hsa-miR-4421	CLIP-seq
MIRT902355	hsa-miR-4470	CLIP-seq
MIRT902356	hsa-miR-4480	CLIP-seq
MIRT1967677	hsa-miR-4526	CLIP-seq
MIRT902357	hsa-miR-4636	CLIP-seq
MIRT902358	hsa-miR-4646-3p	CLIP-seq
MIRT902359	hsa-miR-4652-5p	CLIP-seq
MIRT902362	hsa-miR-4662a-5p	CLIP-seq
MIRT1967678	hsa-miR-4678	CLIP-seq
MIRT902363	hsa-miR-4690-3p	CLIP-seq
MIRT1967679	hsa-miR-4691-5p	CLIP-seq
MIRT1967680	hsa-miR-4762-3p	CLIP-seq
MIRT902364	hsa-miR-4771	CLIP-seq
MIRT902365	hsa-miR-4789-5p	CLIP-seq
MIRT1967681	hsa-miR-489	CLIP-seq
MIRT902366	hsa-miR-509-3-5p	CLIP-seq
MIRT902367	hsa-miR-509-5p	CLIP-seq
MIRT902368	hsa-miR-520g	CLIP-seq
MIRT902369	hsa-miR-520h	CLIP-seq
MIRT902371	hsa-miR-548ah	CLIP-seq
MIRT902372	hsa-miR-548p	CLIP-seq
MIRT1967682	hsa-miR-548u	CLIP-seq
MIRT902373	hsa-miR-552	CLIP-seq
MIRT902374	hsa-miR-556-3p	CLIP-seq
MIRT902375	hsa-miR-934	CLIP-seq
MIRT2203425	hsa-miR-1224-3p	CLIP-seq
MIRT2203426	hsa-miR-1275	CLIP-seq
MIRT902324	hsa-miR-145	CLIP-seq
MIRT902327	hsa-miR-2110	CLIP-seq
MIRT902329	hsa-miR-2355-3p	CLIP-seq
MIRT902330	hsa-miR-3074-5p	CLIP-seq
MIRT902331	hsa-miR-3119	CLIP-seq
MIRT2203427	hsa-miR-3121-5p	CLIP-seq
MIRT902332	hsa-miR-3122	CLIP-seq
MIRT902334	hsa-miR-3144-5p	CLIP-seq
MIRT902335	hsa-miR-3150a-3p	CLIP-seq
MIRT902336	hsa-miR-3158-5p	CLIP-seq
MIRT902337	hsa-miR-3166	CLIP-seq
MIRT902338	hsa-miR-3191	CLIP-seq
MIRT902339	hsa-miR-323-3p	CLIP-seq
MIRT2203428	hsa-miR-3667-3p	CLIP-seq
MIRT902342	hsa-miR-3689a-3p	CLIP-seq
MIRT902343	hsa-miR-3689c	CLIP-seq
MIRT902344	hsa-miR-3691-3p	CLIP-seq
MIRT902346	hsa-miR-382	CLIP-seq
MIRT902347	hsa-miR-3913-5p	CLIP-seq
MIRT1967674	hsa-miR-4260	CLIP-seq
MIRT902351	hsa-miR-4267	CLIP-seq
MIRT1967675	hsa-miR-4275	CLIP-seq
MIRT2203429	hsa-miR-4279	CLIP-seq
MIRT902354	hsa-miR-4418	CLIP-seq
MIRT1967676	hsa-miR-4421	CLIP-seq
MIRT902356	hsa-miR-4480	CLIP-seq
MIRT902358	hsa-miR-4646-3p	CLIP-seq
MIRT902359	hsa-miR-4652-5p	CLIP-seq
MIRT902362	hsa-miR-4662a-5p	CLIP-seq
MIRT2203430	hsa-miR-4665-5p	CLIP-seq
MIRT1967678	hsa-miR-4678	CLIP-seq
MIRT1967679	hsa-miR-4691-5p	CLIP-seq
MIRT902364	hsa-miR-4771	CLIP-seq
MIRT902365	hsa-miR-4789-5p	CLIP-seq
MIRT2203431	hsa-miR-483-3p	CLIP-seq
MIRT902366	hsa-miR-509-3-5p	CLIP-seq
MIRT902367	hsa-miR-509-5p	CLIP-seq
MIRT902373	hsa-miR-552	CLIP-seq
MIRT902374	hsa-miR-556-3p	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	NAS	27066481
GO:0000139	Component	Golgi membrane	TAS
GO:0000301	Process	Retrograde transport, vesicle recycling within Golgi	IMP	27066481
GO:0005515	Function	Protein binding	IPI	25416956, 26871637, 32814053
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006891	Process	Intra-Golgi vesicle-mediated transport	IBA
GO:0007030	Process	Golgi organization	IMP	27066481
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0017119	Component	Golgi transport complex	IBA
GO:0017119	Component	Golgi transport complex	IDA	15047703
GO:0017119	Component	Golgi transport complex	IEA
GO:0017119	Component	Golgi transport complex	NAS	11703943, 27066481
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0070085	Process	Glycosylation	IMP	27066481

MIM	HGNC	e!Ensembl
606979	18623	ENSG00000213380

Q96MW5

Protein name

Conserved oligomeric Golgi complex subunit 8 (COG complex subunit 8) (Component of oligomeric Golgi complex 8)

Protein function

Required for normal Golgi function.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04124	Dor1	50 → 388	Dor1-like family	Family

Sequence

MATAATIPSVATATAAALGEVEDEGLLASLFRDRFPEAQWRERPDVGRYLRELSGSGLER
LRREPERLAEERAQLLQQTRDLAFANYKTFIRGAECTERIHRLFGDVEASLGRLLDRLPS
FQQSCRNFVKEAEEISSNRRMNSLTLNRHTEILEILEIPQLMDTCVRNSYYEEALELAAY
VRRLERKYSSIPVIQGIVNEVRQSMQLMLSQLIQQLRTNIQLPACLRVIGYLRRMDVFTE
AELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEASRVHLFDIITQYRAIFSDEDPLL
PPAMGEHTVNESAIFHGWVLQKVSQFLQVLETDLYRGIGGHLDSLLGQCMYFGLSFSRVG
ADFRGQLAPVFQRVAISTFQKAIQETVEKFQEEMNSYMLISAPAILGTSNMPAAVPATQP
GTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFH
RAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNL
GHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGR
AETQAEPPSVGP

Sequence length

612

Interactions

View interactions

	Reactome
			COPI-mediated anterograde transport Intra-Golgi traffic Retrograde transport at the Trans-Golgi-Network

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
COG8-congenital disorder of glycosylation	Likely pathogenic; Pathogenic	rs771045945, rs2143335414, rs121434387, rs1264383808, rs766244312, rs1597225261, rs1287837570, rs780534334	RCV003485867 RCV001420140 RCV000003832 RCV000003833 RCV000003834 RCV000816521 RCV001200906 RCV001241783 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
COG8-related disorder	Likely pathogenic; Pathogenic	rs766244312, rs201289118, rs780534334	RCV003407266 RCV003399757 RCV003399001	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COG8-CDG	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital disorder of glycosylation	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIH	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISORDERS OF GLYCOSYLATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute encephalopathy	Encephalopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alternating esotropia	Alternating esotropia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	26045774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis multiplex congenita	BEFREE	30690882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy/Degeneration affecting the brainstem	Brainstem Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26045774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26045774, 34539936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic axonal neuropathy	Neuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
COG8-CDG	Congenital Disorder Of Glycosylation	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26045774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26045774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of face	Facial dysmorphism	BEFREE	30690882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1s	Congenital disorder of glycosylation	BEFREE	30690882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorder Of Glycosylation Type In	Congenital disorder of glycosylation	Pubtator	37083278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE Ii	Congenital disorder of glycosylation	BEFREE	17220172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Disorder Of Glycosylation, Type IIH	Congenital disorder of glycosylation	GENOMICS_ENGLAND_DG	11980916, 17220172, 17331980, 27604308		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Disorder Of Glycosylation, Type IIH	Congenital disorder of glycosylation	BEFREE	17220172, 17331980		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Disorder Of Glycosylation, Type IIH	Congenital disorder of glycosylation	ORPHANET_DG	17331980		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Disorder Of Glycosylation, Type IIH	Congenital disorder of glycosylation	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Disorder Of Glycosylation, Type IIH	Congenital disorder of glycosylation	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	17331980, 18353293, 23865579, 25192513, 28619360, 28883096, 30690882		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	37083278	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	BEFREE	30690882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26045774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Food intolerance (disorder)	Food Intolerance	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26045774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26045774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26045774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26045774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	26045774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	19690088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein-Losing Enteropathies	Protein-losing enteropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous hematomas	Hematomas	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26045774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xanthomatosis Cerebrotendinous	Xanthomatosis	Pubtator	37083278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

COG8 (component of oligomeric golgi complex 8)