Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8434
Gene name	Reversion inducing cysteine rich protein with kazal motifs
Gene symbol	RECK
Synonyms (NCBI Gene)	ST15
Chromosome	9
Chromosome location	9p13.3
Summary	The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anch

420

Show/Hide all (420)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000969	hsa-miR-21-5p	qRT-PCRLuciferase reporter assayWestern blot	18794849
MIRT000969	hsa-miR-21-5p	qRT-PCRLuciferase reporter assayWestern blot	18794849
MIRT000969	hsa-miR-21-5p	Western blot	18591254
MIRT000969	hsa-miR-21-5p	qRT-PCR	18591254
MIRT000969	hsa-miR-21-5p	Luciferase reporter assay	18591254
MIRT000969	hsa-miR-21-5p	Luciferase reporter assay	18591254
MIRT000969	hsa-miR-21-5p	Review	19935707
MIRT000607	hsa-miR-15b-5p	Western blotqRT-PCRLuciferase reporter assay	20154725
MIRT000969	hsa-miR-21-5p	Western blotqRT-PCRLuciferase reporter assay	20154725
MIRT000606	hsa-miR-373-3p	Western blotqRT-PCRLuciferase reporter assay	20154725
MIRT000969	hsa-miR-21-5p	Luciferase reporter assay	18591254
MIRT000969	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	20480266
MIRT000969	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	20480266
MIRT006728	hsa-miR-222-3p	Luciferase reporter assay	22321642
MIRT006728	hsa-miR-222-3p	Luciferase reporter assay	22321642
MIRT000969	hsa-miR-21-5p	5.0	22630347
MIRT007090	hsa-miR-15a-5p	GFP reporter assayqRT-PCR	23176145
MIRT007090	hsa-miR-15a-5p	GFP reporter assayqRT-PCR	23176145
MIRT007293	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23333633
MIRT007293	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23333633
MIRT007293	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23333633
MIRT007293	hsa-miR-182-5p	Luciferase reporter assay	23226455
MIRT007293	hsa-miR-182-5p	Luciferase reporter assay	23383207
MIRT018129	hsa-miR-335-5p	Microarray	18185580
MIRT022764	hsa-miR-124-3p	Microarray	18668037
MIRT027078	hsa-miR-103a-3p	Sequencing	20371350
MIRT000969	hsa-miR-21-5p	Reporter assay;Western blot;Other	18794849
MIRT000969	hsa-miR-21-5p	Reporter assay;Western blot;qRT-PCR;Microarray	18591254
MIRT031373	hsa-miR-16-5p	Sequencing	20371350
MIRT031373	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	24852767
MIRT031373	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	24852767
MIRT000969	hsa-miR-21-5p	Luciferase reporter assayWestern blot	23504349
MIRT053577	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	24078004
MIRT053577	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	24078004
MIRT054260	hsa-miR-374b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25516656
MIRT054260	hsa-miR-374b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25516656
MIRT054260	hsa-miR-374b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25516656
MIRT054260	hsa-miR-374b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25516656
MIRT054260	hsa-miR-374b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25516656
MIRT054260	hsa-miR-374b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	25516656
MIRT000969	hsa-miR-21-5p	qRT-PCRWestern blot	24594117
MIRT000969	hsa-miR-21-5p	Luciferase reporter assayWestern blot	23708209
MIRT438699	rno-miR-200c-3p	qRT-PCRWestern blot	24647918
MIRT438699	rno-miR-200c-3p	qRT-PCRWestern blot	24647918
MIRT438481	hsa-miR-92b-3p	Luciferase reporter assay	24162673
MIRT438481	hsa-miR-92b-3p	Luciferase reporter assay	24162673
MIRT000969	hsa-miR-21-5p	ImmunofluorescenceImmunohistochemistryqRT-PCRWestern blot	23811941
MIRT438045	hsa-miR-96-5p	Luciferase reporter assayqRT-PCRWestern blot	24366472
MIRT438045	hsa-miR-96-5p	Luciferase reporter assayqRT-PCRWestern blot	24366472
MIRT438699	rno-miR-200c-3p	qRT-PCRWestern blot	24647918
MIRT438699	rno-miR-200c-3p	qRT-PCRWestern blot	24647918
MIRT438481	hsa-miR-92b-3p	Luciferase reporter assay	24162673
MIRT438481	hsa-miR-92b-3p	Luciferase reporter assay	24162673
MIRT000969	hsa-miR-21-5p	ImmunofluorescenceImmunohistochemistryqRT-PCRWestern blot	23811941
MIRT438045	hsa-miR-96-5p	Luciferase reporter assayqRT-PCRWestern blot	24366472
MIRT438045	hsa-miR-96-5p	Luciferase reporter assayqRT-PCRWestern blot	24366472
MIRT031373	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT107688	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT107690	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT000607	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT007090	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT107689	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT107699	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT554845	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT007293	hsa-miR-182-5p	PAR-CLIP	21572407
MIRT554844	hsa-miR-548ac	PAR-CLIP	21572407
MIRT554843	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT554842	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT554841	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT554840	hsa-miR-548z	PAR-CLIP	21572407
MIRT554839	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT554838	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT554837	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT554836	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT554835	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT554834	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT554833	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT554832	hsa-miR-618	PAR-CLIP	21572407
MIRT107692	hsa-miR-562	PAR-CLIP	21572407
MIRT554831	hsa-miR-646	PAR-CLIP	21572407
MIRT554830	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT554829	hsa-miR-299-5p	PAR-CLIP	21572407
MIRT107696	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT107698	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT554828	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT554827	hsa-miR-29b-2-5p	PAR-CLIP	21572407
MIRT554826	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT438045	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT454996	hsa-miR-3714	PAR-CLIP	23592263
MIRT454995	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT454994	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT454993	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT454992	hsa-miR-940	PAR-CLIP	23592263
MIRT454991	hsa-miR-3922-5p	PAR-CLIP	23592263
MIRT454990	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT454989	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT454988	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT454987	hsa-miR-6134	PAR-CLIP	23592263
MIRT454986	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT454985	hsa-miR-5192	PAR-CLIP	23592263
MIRT454984	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT454982	hsa-miR-7154-3p	PAR-CLIP	23592263
MIRT454983	hsa-miR-765	PAR-CLIP	23592263
MIRT454981	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT454980	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT454979	hsa-miR-1294	PAR-CLIP	23592263
MIRT454978	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT731169	hsa-miR-135b-5p	Western blotLuciferase reporter assay	25537516
MIRT731169	hsa-miR-135b-5p	Western blotLuciferase reporter assay	25537516
MIRT731853	hsa-miR-15b-3p	Western blot	27530410
MIRT731853	hsa-miR-15b-3p	Western blot	27530410
MIRT054649	hsa-miR-221-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	26364844
MIRT054649	hsa-miR-221-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	26364844
MIRT006728	hsa-miR-222-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	26364844
MIRT006728	hsa-miR-222-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	26364844
MIRT731975	hsa-miR-409-3p	Luciferase reporter assay	27158382
MIRT731975	hsa-miR-409-3p	Luciferase reporter assay	27158382
MIRT000969	hsa-miR-21-5p	qRT-PCRWestern blot	26741162
MIRT007293	hsa-miR-182-5p	qRT-PCRWestern blot	26609496
MIRT438045	hsa-miR-96-5p	qRT-PCRWestern blot	26609496
MIRT438481	hsa-miR-92b-3p	Luciferase reporter assay	26993249
MIRT438481	hsa-miR-92b-3p	Luciferase reporter assay	26993249
MIRT438481	hsa-miR-92b-3p	Luciferase reporter assay	26993249
MIRT438481	hsa-miR-92b-3p	Luciferase reporter assay	26993249
MIRT438481	hsa-miR-92b-3p	5.0	26993249
MIRT438481	hsa-miR-92b-3p	5.0	26993249
MIRT438481	hsa-miR-92b-3p	5.0	26993249
MIRT438481	hsa-miR-92b-3p	5.0	26993249
MIRT736966	hsa-miR-145-5p	ChIP-seqqRT-PCR	32221048
MIRT031373	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT107688	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT107690	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT000607	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT007090	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT107689	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT107699	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT554845	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT007293	hsa-miR-182-5p	PAR-CLIP	21572407
MIRT554844	hsa-miR-548ac	PAR-CLIP	21572407
MIRT554843	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT554842	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT554841	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT554840	hsa-miR-548z	PAR-CLIP	21572407
MIRT554839	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT554838	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT554837	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT554836	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT554835	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT554834	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT554833	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT554832	hsa-miR-618	PAR-CLIP	21572407
MIRT107692	hsa-miR-562	PAR-CLIP	21572407
MIRT554831	hsa-miR-646	PAR-CLIP	21572407
MIRT554830	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT554829	hsa-miR-299-5p	PAR-CLIP	21572407
MIRT107696	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT107698	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT554828	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT554827	hsa-miR-29b-2-5p	PAR-CLIP	21572407
MIRT554826	hsa-miR-1271-5p	PAR-CLIP	21572407
MIRT438045	hsa-miR-96-5p	PAR-CLIP	21572407
MIRT454996	hsa-miR-3714	PAR-CLIP	23592263
MIRT454995	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT454994	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT454993	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT454992	hsa-miR-940	PAR-CLIP	23592263
MIRT454991	hsa-miR-3922-5p	PAR-CLIP	23592263
MIRT454990	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT454989	hsa-miR-4693-3p	PAR-CLIP	23592263
MIRT454988	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT454987	hsa-miR-6134	PAR-CLIP	23592263
MIRT454986	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT454985	hsa-miR-5192	PAR-CLIP	23592263
MIRT454984	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT454982	hsa-miR-7154-3p	PAR-CLIP	23592263
MIRT454983	hsa-miR-765	PAR-CLIP	23592263
MIRT454981	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT454980	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT454979	hsa-miR-1294	PAR-CLIP	23592263
MIRT454978	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT1299234	hsa-miR-329	CLIP-seq
MIRT1299235	hsa-miR-362-3p	CLIP-seq
MIRT1299236	hsa-miR-3671	CLIP-seq
MIRT1299237	hsa-miR-369-3p	CLIP-seq
MIRT1299238	hsa-miR-374a	CLIP-seq
MIRT1299239	hsa-miR-374b	CLIP-seq
MIRT1299240	hsa-miR-3941	CLIP-seq
MIRT1299241	hsa-miR-4291	CLIP-seq
MIRT1299242	hsa-miR-4696	CLIP-seq
MIRT1299243	hsa-miR-4731-3p	CLIP-seq
MIRT1299244	hsa-miR-4801	CLIP-seq
MIRT1299245	hsa-miR-499-3p	CLIP-seq
MIRT1299246	hsa-miR-499a-3p	CLIP-seq
MIRT1299247	hsa-miR-545	CLIP-seq
MIRT1299248	hsa-miR-603	CLIP-seq
MIRT1299249	hsa-miR-607	CLIP-seq
MIRT1553056	hsa-miR-1271	CLIP-seq
MIRT1553057	hsa-miR-15a	CLIP-seq
MIRT1553058	hsa-miR-15b	CLIP-seq
MIRT1553059	hsa-miR-16	CLIP-seq
MIRT1553060	hsa-miR-182	CLIP-seq
MIRT1553061	hsa-miR-195	CLIP-seq
MIRT1553062	hsa-miR-21	CLIP-seq
MIRT1299236	hsa-miR-3671	CLIP-seq
MIRT1553063	hsa-miR-410	CLIP-seq
MIRT1553064	hsa-miR-424	CLIP-seq
MIRT1553065	hsa-miR-4524	CLIP-seq
MIRT1553066	hsa-miR-4719	CLIP-seq
MIRT1553067	hsa-miR-494	CLIP-seq
MIRT1553068	hsa-miR-497	CLIP-seq
MIRT1553069	hsa-miR-503	CLIP-seq
MIRT1553070	hsa-miR-548g	CLIP-seq
MIRT1299249	hsa-miR-607	CLIP-seq
MIRT1553071	hsa-miR-96	CLIP-seq
MIRT1553056	hsa-miR-1271	CLIP-seq
MIRT1553060	hsa-miR-182	CLIP-seq
MIRT1553071	hsa-miR-96	CLIP-seq
MIRT2089067	hsa-miR-3613-3p	CLIP-seq
MIRT1553066	hsa-miR-4719	CLIP-seq
MIRT2089068	hsa-miR-5096	CLIP-seq
MIRT2313897	hsa-miR-4272	CLIP-seq
MIRT2432584	hsa-miR-1206	CLIP-seq
MIRT2432585	hsa-miR-1248	CLIP-seq
MIRT2432586	hsa-miR-1255a	CLIP-seq
MIRT2432587	hsa-miR-1255b	CLIP-seq
MIRT1553056	hsa-miR-1271	CLIP-seq
MIRT2432588	hsa-miR-1283	CLIP-seq
MIRT2432589	hsa-miR-1305	CLIP-seq
MIRT2432590	hsa-miR-1324	CLIP-seq
MIRT2432591	hsa-miR-135a	CLIP-seq
MIRT2432592	hsa-miR-135b	CLIP-seq
MIRT1553057	hsa-miR-15a	CLIP-seq
MIRT1553058	hsa-miR-15b	CLIP-seq
MIRT1553059	hsa-miR-16	CLIP-seq
MIRT2432593	hsa-miR-181a	CLIP-seq
MIRT2432594	hsa-miR-181b	CLIP-seq
MIRT2432595	hsa-miR-181c	CLIP-seq
MIRT2432596	hsa-miR-181d	CLIP-seq
MIRT1553060	hsa-miR-182	CLIP-seq
MIRT2432597	hsa-miR-188-5p	CLIP-seq
MIRT2432598	hsa-miR-1910	CLIP-seq
MIRT1553061	hsa-miR-195	CLIP-seq
MIRT2432599	hsa-miR-200b	CLIP-seq
MIRT2432600	hsa-miR-200c	CLIP-seq
MIRT1553062	hsa-miR-21	CLIP-seq
MIRT2432601	hsa-miR-219-5p	CLIP-seq
MIRT2432602	hsa-miR-302a	CLIP-seq
MIRT2432603	hsa-miR-302b	CLIP-seq
MIRT2432604	hsa-miR-302c	CLIP-seq
MIRT2432605	hsa-miR-302d	CLIP-seq
MIRT2432606	hsa-miR-302e	CLIP-seq
MIRT2432607	hsa-miR-3074-3p	CLIP-seq
MIRT2432608	hsa-miR-3117-5p	CLIP-seq
MIRT2432609	hsa-miR-3121-3p	CLIP-seq
MIRT2432610	hsa-miR-3126-3p	CLIP-seq
MIRT2432611	hsa-miR-3140-5p	CLIP-seq
MIRT2432612	hsa-miR-3163	CLIP-seq
MIRT1299234	hsa-miR-329	CLIP-seq
MIRT2432613	hsa-miR-3607-5p	CLIP-seq
MIRT1299235	hsa-miR-362-3p	CLIP-seq
MIRT1299236	hsa-miR-3671	CLIP-seq
MIRT2432614	hsa-miR-3682-5p	CLIP-seq
MIRT2432615	hsa-miR-3688-3p	CLIP-seq
MIRT1299237	hsa-miR-369-3p	CLIP-seq
MIRT2432616	hsa-miR-371b-3p	CLIP-seq
MIRT2432617	hsa-miR-372	CLIP-seq
MIRT2432618	hsa-miR-373	CLIP-seq
MIRT1299238	hsa-miR-374a	CLIP-seq
MIRT1299239	hsa-miR-374b	CLIP-seq
MIRT2432619	hsa-miR-374c	CLIP-seq
MIRT2432620	hsa-miR-3924	CLIP-seq
MIRT1299240	hsa-miR-3941	CLIP-seq
MIRT2432621	hsa-miR-3942-3p	CLIP-seq
MIRT2432622	hsa-miR-3973	CLIP-seq
MIRT2432623	hsa-miR-3978	CLIP-seq
MIRT1553063	hsa-miR-410	CLIP-seq
MIRT1553064	hsa-miR-424	CLIP-seq
MIRT2432624	hsa-miR-4257	CLIP-seq
MIRT2432625	hsa-miR-4262	CLIP-seq
MIRT2313897	hsa-miR-4272	CLIP-seq
MIRT2432626	hsa-miR-4274	CLIP-seq
MIRT2432627	hsa-miR-4289	CLIP-seq
MIRT2432628	hsa-miR-429	CLIP-seq
MIRT1299241	hsa-miR-4291	CLIP-seq
MIRT2432629	hsa-miR-4445	CLIP-seq
MIRT2432630	hsa-miR-448	CLIP-seq
MIRT2432631	hsa-miR-4495	CLIP-seq
MIRT1553065	hsa-miR-4524	CLIP-seq
MIRT2432632	hsa-miR-4530	CLIP-seq
MIRT2432633	hsa-miR-4641	CLIP-seq
MIRT2432634	hsa-miR-4643	CLIP-seq
MIRT2432635	hsa-miR-466	CLIP-seq
MIRT2432636	hsa-miR-4666-5p	CLIP-seq
MIRT2432637	hsa-miR-4668-3p	CLIP-seq
MIRT2432638	hsa-miR-4699-3p	CLIP-seq
MIRT1553066	hsa-miR-4719	CLIP-seq
MIRT2432639	hsa-miR-4729	CLIP-seq
MIRT1299243	hsa-miR-4731-3p	CLIP-seq
MIRT2432640	hsa-miR-4766-5p	CLIP-seq
MIRT2432641	hsa-miR-4778-3p	CLIP-seq
MIRT2432642	hsa-miR-4778-5p	CLIP-seq
MIRT2432643	hsa-miR-4782-3p	CLIP-seq
MIRT2432644	hsa-miR-4789-3p	CLIP-seq
MIRT2432645	hsa-miR-4795-3p	CLIP-seq
MIRT1299244	hsa-miR-4801	CLIP-seq
MIRT1553067	hsa-miR-494	CLIP-seq
MIRT1553068	hsa-miR-497	CLIP-seq
MIRT2432646	hsa-miR-498	CLIP-seq
MIRT1299245	hsa-miR-499-3p	CLIP-seq
MIRT1299246	hsa-miR-499a-3p	CLIP-seq
MIRT1553069	hsa-miR-503	CLIP-seq
MIRT2432647	hsa-miR-508-3p	CLIP-seq
MIRT2089068	hsa-miR-5096	CLIP-seq
MIRT2432648	hsa-miR-510	CLIP-seq
MIRT2432649	hsa-miR-511	CLIP-seq
MIRT2432650	hsa-miR-512-5p	CLIP-seq
MIRT2432651	hsa-miR-519a	CLIP-seq
MIRT2432652	hsa-miR-519b-3p	CLIP-seq
MIRT2432653	hsa-miR-519c-3p	CLIP-seq
MIRT2432654	hsa-miR-520a-3p	CLIP-seq
MIRT2432655	hsa-miR-520b	CLIP-seq
MIRT2432656	hsa-miR-520c-3p	CLIP-seq
MIRT2432657	hsa-miR-520d-3p	CLIP-seq
MIRT2432658	hsa-miR-520d-5p	CLIP-seq
MIRT2432659	hsa-miR-520e	CLIP-seq
MIRT2432660	hsa-miR-520g	CLIP-seq
MIRT2432661	hsa-miR-520h	CLIP-seq
MIRT2432662	hsa-miR-524-5p	CLIP-seq
MIRT1299247	hsa-miR-545	CLIP-seq
MIRT2432663	hsa-miR-548ae	CLIP-seq
MIRT2432664	hsa-miR-548aj	CLIP-seq
MIRT2432665	hsa-miR-548am	CLIP-seq
MIRT1553070	hsa-miR-548g	CLIP-seq
MIRT2432666	hsa-miR-548l	CLIP-seq
MIRT2432667	hsa-miR-548x	CLIP-seq
MIRT1299248	hsa-miR-603	CLIP-seq
MIRT1299249	hsa-miR-607	CLIP-seq
MIRT2432668	hsa-miR-616	CLIP-seq
MIRT2432669	hsa-miR-634	CLIP-seq
MIRT2432670	hsa-miR-655	CLIP-seq
MIRT2432671	hsa-miR-889	CLIP-seq
MIRT2432672	hsa-miR-890	CLIP-seq
MIRT2432673	hsa-miR-944	CLIP-seq
MIRT1553071	hsa-miR-96	CLIP-seq
MIRT1553066	hsa-miR-4719	CLIP-seq
MIRT2432590	hsa-miR-1324	CLIP-seq
MIRT2432597	hsa-miR-188-5p	CLIP-seq
MIRT2432602	hsa-miR-302a	CLIP-seq
MIRT2432603	hsa-miR-302b	CLIP-seq
MIRT2432604	hsa-miR-302c	CLIP-seq
MIRT2432605	hsa-miR-302d	CLIP-seq
MIRT2432606	hsa-miR-302e	CLIP-seq
MIRT2432607	hsa-miR-3074-3p	CLIP-seq
MIRT2432608	hsa-miR-3117-5p	CLIP-seq
MIRT2089067	hsa-miR-3613-3p	CLIP-seq
MIRT2610476	hsa-miR-3659	CLIP-seq
MIRT2432614	hsa-miR-3682-5p	CLIP-seq
MIRT1299237	hsa-miR-369-3p	CLIP-seq
MIRT2432616	hsa-miR-371b-3p	CLIP-seq
MIRT2432617	hsa-miR-372	CLIP-seq
MIRT2432618	hsa-miR-373	CLIP-seq
MIRT1299238	hsa-miR-374a	CLIP-seq
MIRT1299239	hsa-miR-374b	CLIP-seq
MIRT2432620	hsa-miR-3924	CLIP-seq
MIRT1553063	hsa-miR-410	CLIP-seq
MIRT1299241	hsa-miR-4291	CLIP-seq
MIRT2432633	hsa-miR-4641	CLIP-seq
MIRT2610477	hsa-miR-4658	CLIP-seq
MIRT1553066	hsa-miR-4719	CLIP-seq
MIRT2432639	hsa-miR-4729	CLIP-seq
MIRT2432640	hsa-miR-4766-5p	CLIP-seq
MIRT2432642	hsa-miR-4778-5p	CLIP-seq
MIRT2432651	hsa-miR-519a	CLIP-seq
MIRT2432652	hsa-miR-519b-3p	CLIP-seq
MIRT2432653	hsa-miR-519c-3p	CLIP-seq
MIRT2432654	hsa-miR-520a-3p	CLIP-seq
MIRT2432655	hsa-miR-520b	CLIP-seq
MIRT2432656	hsa-miR-520c-3p	CLIP-seq
MIRT2432657	hsa-miR-520d-3p	CLIP-seq
MIRT2432659	hsa-miR-520e	CLIP-seq
MIRT1299247	hsa-miR-545	CLIP-seq
MIRT2610478	hsa-miR-574-5p	CLIP-seq
MIRT2432668	hsa-miR-616	CLIP-seq
MIRT2432673	hsa-miR-944	CLIP-seq
MIRT2689635	hsa-miR-153	CLIP-seq
MIRT2432602	hsa-miR-302a	CLIP-seq
MIRT2432603	hsa-miR-302b	CLIP-seq
MIRT2432604	hsa-miR-302c	CLIP-seq
MIRT2432605	hsa-miR-302d	CLIP-seq
MIRT2432606	hsa-miR-302e	CLIP-seq
MIRT2432608	hsa-miR-3117-5p	CLIP-seq
MIRT2689636	hsa-miR-3140-3p	CLIP-seq
MIRT2610476	hsa-miR-3659	CLIP-seq
MIRT2432616	hsa-miR-371b-3p	CLIP-seq
MIRT2432617	hsa-miR-372	CLIP-seq
MIRT2432618	hsa-miR-373	CLIP-seq
MIRT1553063	hsa-miR-410	CLIP-seq
MIRT1299241	hsa-miR-4291	CLIP-seq
MIRT2432630	hsa-miR-448	CLIP-seq
MIRT2689637	hsa-miR-450b-5p	CLIP-seq
MIRT2432633	hsa-miR-4641	CLIP-seq
MIRT2610477	hsa-miR-4658	CLIP-seq
MIRT1553066	hsa-miR-4719	CLIP-seq
MIRT2432639	hsa-miR-4729	CLIP-seq
MIRT2432640	hsa-miR-4766-5p	CLIP-seq
MIRT2432642	hsa-miR-4778-5p	CLIP-seq
MIRT2689638	hsa-miR-507	CLIP-seq
MIRT2432651	hsa-miR-519a	CLIP-seq
MIRT2432652	hsa-miR-519b-3p	CLIP-seq
MIRT2432653	hsa-miR-519c-3p	CLIP-seq
MIRT2432654	hsa-miR-520a-3p	CLIP-seq
MIRT2432655	hsa-miR-520b	CLIP-seq
MIRT2432656	hsa-miR-520c-3p	CLIP-seq
MIRT2432657	hsa-miR-520d-3p	CLIP-seq
MIRT2432659	hsa-miR-520e	CLIP-seq
MIRT1299247	hsa-miR-545	CLIP-seq
MIRT2689639	hsa-miR-557	CLIP-seq
MIRT2610478	hsa-miR-574-5p	CLIP-seq
MIRT2432668	hsa-miR-616	CLIP-seq
MIRT2432673	hsa-miR-944	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
HDAC1	Activation	20442303
HDAC1	Repression	20442303
HDAC1	Unknown	16377629
HDAC4	Unknown	22781396
HIF1A	Repression	20442303
SP1	Activation	17828469
SP1	Unknown	16377629
SP3	Unknown	16377629

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001955	Process	Blood vessel maturation	IBA
GO:0001955	Process	Blood vessel maturation	IEA
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0004866	Function	Endopeptidase inhibitor activity	IBA
GO:0004866	Function	Endopeptidase inhibitor activity	IDA	9789069
GO:0004866	Function	Endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	21255571
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007566	Process	Embryo implantation	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IDA	18194466
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	TAS	9789069
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	IEA
GO:0010716	Process	Negative regulation of extracellular matrix disassembly	ISS
GO:0015026	Function	Coreceptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9789069
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	18591254
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0035115	Process	Embryonic forelimb morphogenesis	IEA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060828	Process	Regulation of canonical Wnt signaling pathway	IBA
GO:0090210	Process	Regulation of establishment of blood-brain barrier	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0098552	Component	Side of membrane	IEA
GO:1903053	Process	Regulation of extracellular matrix organization	IMP	18591254
GO:1990909	Component	Wnt signalosome	IEA

MIM	HGNC	e!Ensembl
605227	11345	ENSG00000122707

O95980

Protein name

Reversion-inducing cysteine-rich protein with Kazal motifs (hRECK) (Suppressor of tumorigenicity 15 protein)

Protein function

Functions together with ADGRA2 to enable brain endothelial cells to selectively respond to Wnt7 signals (WNT7A or WNT7B) (PubMed:28289266, PubMed:30026314). Plays a key role in Wnt7-specific responses: required for central nervous system (CNS) a

PDB

8TZP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07648	Kazal_2	631 → 671	Kazal-type serine protease inhibitor domain	Domain
PF07648	Kazal_2	712 → 750	Kazal-type serine protease inhibitor domain	Domain
PF07648	Kazal_2	749 → 787	Kazal-type serine protease inhibitor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in various tissues and untransformed cells (PubMed:9789069). It is undetectable in tumor-derived cell lines and oncogenically transformed cells (PubMed:9789069). {ECO:0000269|PubMed:9789069}.

Sequence

MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSE
SRLKHLLQRAPDYCPETMVEIWNCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQA
SSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQI
KAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNACKRILMSKKTEM
EIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTST
CRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGCRNLTYCTNFN
NRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIK
PCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRP
STLGNIVEEVTHPCNPNPCPANELCEVNRKGCPSGDPCLPYFCVQGCKLGEASDFIVRQG
TLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNV
CSCFAGNLVCSTRLCLSEHSSEDDRRTFTGLPCNCADQFVPVCGQNGRTYPSACIARCVG
LQDHQFEFGSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFDKFGCSQYECVPRQLACDQVQ
DPVCDTDHMEHNNLCTLYQRGKSLSYKGPCQPFCRATEPVCGHNGETYSSVCAAYSDRVA
VDYYGDCQAVGVLSEHSSVAECASVKCPSLLAAGCKPIIPPGACCPLCAGMLRVLFDKEK
LDTIAKVTNKKPITVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIIPVDHYPKALQIE
ACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSVPSAGVRARPSCHSLLLPLSL
GLALHLLWTYN

Sequence length

971

Interactions

View interactions

	KEGG		Reactome
	MicroRNAs in cancer		Post-translational modification: synthesis of GPI-anchored proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORY PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (144)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	17714826, 20032402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17714826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25517920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33731436	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	19995435	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	24646032, 28340422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	24812324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15485996	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17088949	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	36835202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	26431549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	18194448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	16806661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21613799, 23226455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12767082, 19144199, 21255571, 22404079, 24366472, 24931164, 26449734, 26891730, 27058625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12767082, 18263644, 22404079, 24833255, 26449734, 27058625, 38041032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21255571	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	36835202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22438955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16806661, 19250857, 21613799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25517920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22419890, 22428065, 25278269, 25537516, 27268601, 32522890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21613799, 23226455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12447698, 12810630, 17233834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23749490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24131772	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20032402	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24356192, 25084400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	20395433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29064588		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	17167534, 23679328, 29064588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21076843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27575817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17443689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17443689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17443689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	17443689		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15328199, 24269686, 25826661, 31210300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18425389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31210300, 32221048, 35444107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21076843, 23480766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34205376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	34205376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	26026078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27562596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15485996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	37432109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31862399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	25517920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	27268601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39519143	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31018114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23504349, 29113164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	18023103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29113164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18023103, 24852767, 31866421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	27530410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	LHGDN	19208844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	32206004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	20127710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16791855, 22711523, 23811941, 26431549		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	20127710		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	16791855, 20127710, 22711523, 23811941, 26431549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	20127710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16791855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20127710, 28208619, 31270250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26431549, 28208619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28501516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	25987077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31862399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21565829, 22761427, 27696293, 31618798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11124835, 20447717, 22419890, 22428065, 25278269, 25537516, 25720799, 26921475, 27268601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12810630, 17233834, 18194466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18652766	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18652766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18652766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	40045202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17233834, 18023103, 23679328, 23749490, 27268601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	23679328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28208619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19144199, 21255571, 22404079, 24366472, 24931164, 26449734, 26891730, 27058625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29113164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12447698, 12810630, 17233834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21565829, 22761427, 27696293, 31618798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16806661, 22025325, 22642976, 23383207, 29363862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18794849, 20143471, 26364844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22042554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21613799, 23226455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12507228, 12810630, 16806661, 17725805, 18591254, 18665171, 20154725, 21076843, 21304177, 22158033, 22292753, 22321642, 22428065, 22642976, 22844865 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29805750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29064588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17443689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	17443689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19144199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	26026078		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24335752, 31764436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18665171, 27696293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	BEFREE	27696293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21316416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22844865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25031745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11124835, 12062160, 12507228, 12767082, 15328199, 16132376, 16791855, 16806661, 17233834, 17262820, 17443689, 17714826, 17725805, 18485791, 18665171 View all (43 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	26141647, 30841433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20579139, 23176145, 25987077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23176145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16132376, 17233834, 17714826, 20032402, 24162673, 24469470, 24510537, 25084400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	17233834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17262820, 20480266, 20973064, 26130413, 26993249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	17262820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17262820, 20973064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26130413	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	39519143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33941323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	23749490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12738734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30992669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23749490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	27272560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	27272560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28043014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16806661, 22025325, 22642976, 23383207, 29363862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	16806661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15928670, 22139647, 22642976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17583418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	38387446	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	27575817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15485996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	27575817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	27575817	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17714826, 18485791, 18665171, 20032402, 24356192, 26261088, 31618798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23504349, 24852767, 28454343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31349748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18794849, 20143471, 26364844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18794849, 20143471, 22321642, 25516656, 26364844, 37904179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	30508510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	31074012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22042554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22042554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23226455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	21167264, 21613799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23679328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	27530410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	31074012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	26141647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RECK (reversion inducing cysteine rich protein with kazal motifs)