Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84335
Gene name	AKT1 substrate 1
Gene symbol	AKT1S1
Synonyms (NCBI Gene)	LobePRAS40
Chromosome	19
Chromosome location	19q13.33
Summary	AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008]

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022786	hsa-miR-124-3p	Microarray	18668037
MIRT045373	hsa-miR-185-5p	CLASH	23622248
MIRT041919	hsa-miR-484	CLASH	23622248
MIRT441240	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT441240	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT776479	hsa-miR-1234	CLIP-seq
MIRT776480	hsa-miR-129-3p	CLIP-seq
MIRT776481	hsa-miR-1307	CLIP-seq
MIRT776482	hsa-miR-1469	CLIP-seq
MIRT776483	hsa-miR-146a	CLIP-seq
MIRT776484	hsa-miR-146b-5p	CLIP-seq
MIRT776485	hsa-miR-1908	CLIP-seq
MIRT776486	hsa-miR-3135b	CLIP-seq
MIRT776487	hsa-miR-3668	CLIP-seq
MIRT776488	hsa-miR-3689a-3p	CLIP-seq
MIRT776489	hsa-miR-3689c	CLIP-seq
MIRT776490	hsa-miR-4268	CLIP-seq
MIRT776491	hsa-miR-4330	CLIP-seq
MIRT776492	hsa-miR-4419a	CLIP-seq
MIRT776493	hsa-miR-4463	CLIP-seq
MIRT776494	hsa-miR-4479	CLIP-seq
MIRT776495	hsa-miR-4510	CLIP-seq
MIRT776496	hsa-miR-4524	CLIP-seq
MIRT776497	hsa-miR-4690-5p	CLIP-seq
MIRT776498	hsa-miR-4728-5p	CLIP-seq
MIRT776499	hsa-miR-4732-5p	CLIP-seq
MIRT776500	hsa-miR-4736	CLIP-seq
MIRT776501	hsa-miR-663	CLIP-seq
MIRT776479	hsa-miR-1234	CLIP-seq
MIRT776502	hsa-miR-125a-5p	CLIP-seq
MIRT776503	hsa-miR-125b	CLIP-seq
MIRT776480	hsa-miR-129-3p	CLIP-seq
MIRT776483	hsa-miR-146a	CLIP-seq
MIRT776484	hsa-miR-146b-5p	CLIP-seq
MIRT776504	hsa-miR-3184	CLIP-seq
MIRT776505	hsa-miR-3664-3p	CLIP-seq
MIRT776487	hsa-miR-3668	CLIP-seq
MIRT776488	hsa-miR-3689a-3p	CLIP-seq
MIRT776489	hsa-miR-3689c	CLIP-seq
MIRT776506	hsa-miR-382	CLIP-seq
MIRT776507	hsa-miR-423-5p	CLIP-seq
MIRT776508	hsa-miR-4270	CLIP-seq
MIRT776509	hsa-miR-4280	CLIP-seq
MIRT776510	hsa-miR-4319	CLIP-seq
MIRT776491	hsa-miR-4330	CLIP-seq
MIRT776492	hsa-miR-4419a	CLIP-seq
MIRT776511	hsa-miR-4441	CLIP-seq
MIRT776493	hsa-miR-4463	CLIP-seq
MIRT776512	hsa-miR-4481	CLIP-seq
MIRT776495	hsa-miR-4510	CLIP-seq
MIRT776496	hsa-miR-4524	CLIP-seq
MIRT776513	hsa-miR-4529-5p	CLIP-seq
MIRT776514	hsa-miR-4534	CLIP-seq
MIRT776497	hsa-miR-4690-5p	CLIP-seq
MIRT776498	hsa-miR-4728-5p	CLIP-seq
MIRT776515	hsa-miR-4732-3p	CLIP-seq
MIRT776499	hsa-miR-4732-5p	CLIP-seq
MIRT776516	hsa-miR-4745-5p	CLIP-seq
MIRT776517	hsa-miR-510	CLIP-seq
MIRT776518	hsa-miR-544b	CLIP-seq
MIRT776519	hsa-miR-605	CLIP-seq
MIRT776520	hsa-miR-670	CLIP-seq
MIRT776521	hsa-miR-873	CLIP-seq
MIRT1929232	hsa-miR-216a	CLIP-seq
MIRT1929233	hsa-miR-216b	CLIP-seq
MIRT1929234	hsa-miR-3158-3p	CLIP-seq
MIRT1929235	hsa-miR-3187-3p	CLIP-seq
MIRT1929236	hsa-miR-3192	CLIP-seq
MIRT1929237	hsa-miR-361-3p	CLIP-seq
MIRT1929238	hsa-miR-4314	CLIP-seq
MIRT776491	hsa-miR-4330	CLIP-seq
MIRT1929239	hsa-miR-4435	CLIP-seq
MIRT1929240	hsa-miR-4646-5p	CLIP-seq
MIRT1929241	hsa-miR-4701-5p	CLIP-seq
MIRT1929242	hsa-miR-4721	CLIP-seq
MIRT1929243	hsa-miR-4747-5p	CLIP-seq
MIRT1929244	hsa-miR-4779	CLIP-seq
MIRT1929245	hsa-miR-548s	CLIP-seq
MIRT1929246	hsa-miR-588	CLIP-seq
MIRT2169827	hsa-miR-188-5p	CLIP-seq
MIRT776519	hsa-miR-605	CLIP-seq
MIRT1929232	hsa-miR-216a	CLIP-seq
MIRT1929233	hsa-miR-216b	CLIP-seq
MIRT776491	hsa-miR-4330	CLIP-seq
MIRT2169828	hsa-miR-548a-3p	CLIP-seq
MIRT2169829	hsa-miR-548e	CLIP-seq
MIRT2169830	hsa-miR-548f	CLIP-seq
MIRT2435295	hsa-miR-1252	CLIP-seq
MIRT2169827	hsa-miR-188-5p	CLIP-seq
MIRT2435296	hsa-miR-3154	CLIP-seq
MIRT2435297	hsa-miR-633	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0004860	Function	Protein kinase inhibitor activity	IDA	18372248
GO:0005515	Function	Protein binding	IPI	12524439, 15161933, 17386266, 17604271, 17979178, 18372248, 19648646, 24255178, 28514442, 33961781, 35271311, 36931259
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006469	Process	Negative regulation of protein kinase activity	IDA	17386266
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	17386266, 17510057, 29236692
GO:0031669	Process	Cellular response to nutrient levels	IDA	29750193
GO:0031931	Component	TORC1 complex	IDA	17386266, 31601764
GO:0032007	Process	Negative regulation of TOR signaling	IDA	17386266
GO:0032007	Process	Negative regulation of TOR signaling	IEA
GO:0038202	Process	TORC1 signaling	IDA	12087098, 29750193
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	ISS
GO:0043523	Process	Regulation of neuron apoptotic process	IEA
GO:0043523	Process	Regulation of neuron apoptotic process	ISS
GO:0045792	Process	Negative regulation of cell size	IDA	17386266
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045948	Process	Positive regulation of translational initiation	IDA	1922062, 29750193
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IBA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	17386266, 17510057, 18372248, 29236692

MIM	HGNC	e!Ensembl
610221	28426	ENSG00000204673

Q96B36

Protein name

Proline-rich AKT1 substrate 1 (40 kDa proline-rich AKT substrate)

Protein function

Negative regulator of the mechanistic target of rapamycin complex 1 (mTORC1), an evolutionarily conserved central nutrient sensor that stimulates anabolic reactions and macromolecule biosynthesis to promote cellular biomass generation and growth

PDB

5WBL , 5WBU , 5WBY , 6SB0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15798	PRAS	127 → 251	Proline-rich AKT1 substrate 1	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels of expression in liver and heart. Expressed at higher levels in cancer cell lines (e.g. A-549 and HeLa) than in normal cell lines (e.g. HEK293). {ECO:0000269|PubMed:12524439, ECO:0000269|PubMed:1617

Sequence

MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARR
CLHDIALAHRAATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQL
GISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQY
AKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLP
RPRLNTSDFQKLKRKY

Sequence length

256

Interactions

View interactions

	KEGG		Reactome
	Autophagy - animal mTOR signaling pathway AMPK signaling pathway Longevity regulating pathway Longevity regulating pathway - multiple species Thermogenesis Shigellosis		mTOR signalling mTORC1-mediated signalling AKT phosphorylates targets in the cytosol HSF1-dependent transactivation Constitutive Signaling by AKT1 E17K in Cancer

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (50)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28945219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22873724, 23159938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31728028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31728028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Diffuse	Brain injuries	Pubtator	36894313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16174443, 31173106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24704832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16174443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35140327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	17457363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28050343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25714871, 35635239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26876154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28945219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	22241085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30666556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30129426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30129426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19705067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35287169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	LHGDN	17277771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	31849836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	24576065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	22879939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31281449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28050343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	21886838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21886838, 27226530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25703929, 25745995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16174443, 31173106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30666556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	21886838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16174443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31210839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16174443, 26003731, 28945219		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17440074, 28064546, 28945219, 28978182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24008870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17440074, 25904681, 25961827, 28978182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	23029019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16174443, 27178817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35088088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	31849836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31210839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31210839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	21886838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26876154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	31740404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	34948236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30119206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35164771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AKT1S1 (AKT1 substrate 1)