Gene Gene information from NCBI Gene database.
Entrez ID 84329
Gene name Hydrogen voltage gated channel 1
Gene symbol HVCN1
Synonyms (NCBI Gene)
HV1VSOP
Chromosome 12
Chromosome location 12q24.11
Summary This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody pro
miRNA miRNA information provided by mirtarbase database.
63
miRTarBase ID miRNA Experiments Reference
MIRT1057710 hsa-miR-101 CLIP-seq
MIRT1057711 hsa-miR-1183 CLIP-seq
MIRT1057712 hsa-miR-1227 CLIP-seq
MIRT1057713 hsa-miR-144 CLIP-seq
MIRT1057714 hsa-miR-186 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
54
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005216 Function Monoatomic ion channel activity IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 20144758, 22020278
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611227 28240 ENSG00000122986
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96D96
Protein name Voltage-gated hydrogen channel 1 (Hydrogen voltage-gated channel 1) (HV1) (Voltage sensor domain-only protein)
Protein function Voltage-gated proton-selective channel that conducts outward proton currents in response to intracellular acidification. Lacks a canonical ion-channel pore domain and mediates proton permeability via its voltage sensor domain (PubMed:16554753, P
PDB 3A2A , 5OQK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00520 Ion_trans 98 231 Ion transport protein Family
PF16799 VGPC1_C 226 273 C-terminal membrane-localisation domain of ion-channel, VCN1 Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Enriched in immune tissues, such as lymph nodes, B-lymphocytes, monocytes and spleen (PubMed:16554753). Expressed in spermatozoa (PubMed:37669933). Expressed in respiratory epithelial cells (PubMed:20548053). {ECO:0000269|PubMed:165547
Sequence
MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPT
PVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAEL
ILDLKIIQPDKNNYAAMVFHYMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVV
SFILDIVLLFQEHQFEALGLLILLRLWRVARIINGIIISVKTRSE
RQLLRLKQMNVQLAA
KIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN
Sequence length 273
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    ROS and RNS production in phagocytes
Sperm Motility And Taxes
Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATRIAL FIBRILLATION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Autoimmune Diseases Autoimmune Diseases BEFREE 23231444
★☆☆☆☆
Found in Text Mining only
Brain Ischemia Cerebral Ischemia BEFREE 28628214
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 22367212
★☆☆☆☆
Found in Text Mining only
Cerebral Infarction Ischemic stroke Pubtator 32461356, 34228044 Associate
★☆☆☆☆
Found in Text Mining only
Chronic Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 25425665
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 23940591 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 24621823 Stimulate
★☆☆☆☆
Found in Text Mining only
Crohn Disease Crohn disease Pubtator 23437289, 33936061 Associate
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory bowel disease Pubtator 23437289 Associate
★☆☆☆☆
Found in Text Mining only
JOUBERT SYNDROME 13 Joubert Syndrome CLINVAR_DG
★☆☆☆☆
Found in Text Mining only