Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84324
Gene name	SAP domain containing ribonucleoprotein
Gene symbol	SARNP
Synonyms (NCBI Gene)	CIP29HCC1HSPC316THO1
Chromosome	12
Chromosome location	12q13.2
Summary	This gene encodes a protein that is upregulated in response to various cytokines. The encoded protein may play a role in cell cycle progression. A translocation between this gene and the myeloid/lymphoid leukemia gene, resulting in expression of a chimeri

Show/Hide all (89)

miRTarBase ID	miRNA	Experiments
MIRT1326320	hsa-miR-185	CLIP-seq
MIRT1326321	hsa-miR-3185	CLIP-seq
MIRT1326322	hsa-miR-4306	CLIP-seq
MIRT1326323	hsa-miR-4428	CLIP-seq
MIRT1326324	hsa-miR-4644	CLIP-seq
MIRT1326325	hsa-miR-4694-3p	CLIP-seq
MIRT1326326	hsa-miR-539	CLIP-seq
MIRT2321175	hsa-miR-1286	CLIP-seq
MIRT2321176	hsa-miR-1827	CLIP-seq
MIRT1326320	hsa-miR-185	CLIP-seq
MIRT1326321	hsa-miR-3185	CLIP-seq
MIRT2321177	hsa-miR-3622a-5p	CLIP-seq
MIRT1326322	hsa-miR-4306	CLIP-seq
MIRT2321178	hsa-miR-4317	CLIP-seq
MIRT2321179	hsa-miR-4423-3p	CLIP-seq
MIRT1326323	hsa-miR-4428	CLIP-seq
MIRT2321180	hsa-miR-4469	CLIP-seq
MIRT2321181	hsa-miR-4501	CLIP-seq
MIRT1326324	hsa-miR-4644	CLIP-seq
MIRT1326325	hsa-miR-4694-3p	CLIP-seq
MIRT2321182	hsa-miR-4737	CLIP-seq
MIRT1326326	hsa-miR-539	CLIP-seq
MIRT2321183	hsa-miR-940	CLIP-seq
MIRT2321184	hsa-miR-943	CLIP-seq
MIRT2617349	hsa-miR-1206	CLIP-seq
MIRT2321175	hsa-miR-1286	CLIP-seq
MIRT2617350	hsa-miR-141	CLIP-seq
MIRT2321176	hsa-miR-1827	CLIP-seq
MIRT1326320	hsa-miR-185	CLIP-seq
MIRT2617351	hsa-miR-200a	CLIP-seq
MIRT2617352	hsa-miR-224	CLIP-seq
MIRT2617353	hsa-miR-3120-3p	CLIP-seq
MIRT2617354	hsa-miR-3148	CLIP-seq
MIRT1326321	hsa-miR-3185	CLIP-seq
MIRT2321177	hsa-miR-3622a-5p	CLIP-seq
MIRT2617355	hsa-miR-3688-3p	CLIP-seq
MIRT2617356	hsa-miR-3942-5p	CLIP-seq
MIRT1326322	hsa-miR-4306	CLIP-seq
MIRT2321178	hsa-miR-4317	CLIP-seq
MIRT2321179	hsa-miR-4423-3p	CLIP-seq
MIRT1326323	hsa-miR-4428	CLIP-seq
MIRT2617357	hsa-miR-4434	CLIP-seq
MIRT2321180	hsa-miR-4469	CLIP-seq
MIRT2321181	hsa-miR-4501	CLIP-seq
MIRT2617358	hsa-miR-4516	CLIP-seq
MIRT2617359	hsa-miR-4531	CLIP-seq
MIRT1326324	hsa-miR-4644	CLIP-seq
MIRT1326325	hsa-miR-4694-3p	CLIP-seq
MIRT2617360	hsa-miR-4703-5p	CLIP-seq
MIRT2321182	hsa-miR-4737	CLIP-seq
MIRT2617361	hsa-miR-4764-5p	CLIP-seq
MIRT2617362	hsa-miR-490-5p	CLIP-seq
MIRT2617363	hsa-miR-494	CLIP-seq
MIRT1326326	hsa-miR-539	CLIP-seq
MIRT2617364	hsa-miR-570	CLIP-seq
MIRT2617365	hsa-miR-619	CLIP-seq
MIRT2321183	hsa-miR-940	CLIP-seq
MIRT2321184	hsa-miR-943	CLIP-seq
MIRT2617349	hsa-miR-1206	CLIP-seq
MIRT2321175	hsa-miR-1286	CLIP-seq
MIRT2617350	hsa-miR-141	CLIP-seq
MIRT2321176	hsa-miR-1827	CLIP-seq
MIRT1326320	hsa-miR-185	CLIP-seq
MIRT2617351	hsa-miR-200a	CLIP-seq
MIRT2617352	hsa-miR-224	CLIP-seq
MIRT2617353	hsa-miR-3120-3p	CLIP-seq
MIRT2617354	hsa-miR-3148	CLIP-seq
MIRT1326321	hsa-miR-3185	CLIP-seq
MIRT2321177	hsa-miR-3622a-5p	CLIP-seq
MIRT2617355	hsa-miR-3688-3p	CLIP-seq
MIRT2617356	hsa-miR-3942-5p	CLIP-seq
MIRT1326322	hsa-miR-4306	CLIP-seq
MIRT2321178	hsa-miR-4317	CLIP-seq
MIRT2321179	hsa-miR-4423-3p	CLIP-seq
MIRT1326323	hsa-miR-4428	CLIP-seq
MIRT2321180	hsa-miR-4469	CLIP-seq
MIRT2321181	hsa-miR-4501	CLIP-seq
MIRT1326324	hsa-miR-4644	CLIP-seq
MIRT1326325	hsa-miR-4694-3p	CLIP-seq
MIRT2617360	hsa-miR-4703-5p	CLIP-seq
MIRT2321182	hsa-miR-4737	CLIP-seq
MIRT2617361	hsa-miR-4764-5p	CLIP-seq
MIRT2617362	hsa-miR-490-5p	CLIP-seq
MIRT2617363	hsa-miR-494	CLIP-seq
MIRT1326326	hsa-miR-539	CLIP-seq
MIRT2617364	hsa-miR-570	CLIP-seq
MIRT2617365	hsa-miR-619	CLIP-seq
MIRT2321183	hsa-miR-940	CLIP-seq
MIRT2321184	hsa-miR-943	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000346	Component	Transcription export complex	IDA	20844015
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	14667819, 16189514, 18559666, 25416956, 28514442, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	11356193
GO:0005654	Component	Nucleoplasm	TAS
GO:0006406	Process	MRNA export from nucleus	IDA	20844015
GO:0006417	Process	Regulation of translation	IEA
GO:0016607	Component	Nuclear speck	IDA	20844015
GO:0016607	Component	Nuclear speck	IEA
GO:0016973	Process	Poly(A)+ mRNA export from nucleus	IBA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0051028	Process	MRNA transport	IEA

MIM	HGNC	e!Ensembl
610049	24432	ENSG00000205323

P82979

Protein name

SAP domain-containing ribonucleoprotein (Cytokine-induced protein of 29 kDa) (Nuclear protein Hcc-1) (Proliferation-associated cytokine-inducible protein CIP29)

Protein function

Binds both single-stranded and double-stranded DNA with higher affinity for the single-stranded form. Specifically binds to scaffold/matrix attachment region DNA. Also binds single-stranded RNA. Enhances RNA unwinding activity of DDX39A. May par

PDB

2DO1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02037	SAP	8 → 42	SAP domain	Family

Tissue specificity

TISSUE SPECIFICITY: Low expression in spleen, liver, pancreas, testis, thymus, heart, and kidney. Increased levels are seen in hepatocellular carcinoma and pancreatic adenocarcinoma. {ECO:0000269|PubMed:11356193}.

Sequence

MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDET
EEEETKPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKK
AARAARFGISSVPTKGLSSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKER
FGIVTSSAGTGTTEDTEAKKRKRAERFGIA

Sequence length

210

Interactions

View interactions

	Reactome
			Transport of Mature mRNA derived from an Intron-Containing Transcript mRNA 3'-end processing RNA Polymerase II Transcription Termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	11356193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31313837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24643682, 29022480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29042975, 31155499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	BEFREE	14663287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	8551235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	8551235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15825968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	15656986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25524946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25524946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34482648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	8551235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11356193, 29075151, 29472529, 29497780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28357506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31155499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31313837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25524946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24643682, 29022480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14663287, 24643682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21731718, 24972258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24643682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	14663287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15656986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31313837		★★★★★ ★☆☆☆☆ Found in Text Mining only

SARNP (SAP domain containing ribonucleoprotein)