Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84310
Gene name	Cholesin
Gene symbol	CHLSN
Synonyms (NCBI Gene)	C7orf50YCR016W
Chromosome	7
Chromosome location	7p22.3

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments
MIRT852531	hsa-miR-1301	CLIP-seq
MIRT852532	hsa-miR-18a	CLIP-seq
MIRT852533	hsa-miR-18b	CLIP-seq
MIRT852534	hsa-miR-3665	CLIP-seq
MIRT852535	hsa-miR-3937	CLIP-seq
MIRT852536	hsa-miR-4464	CLIP-seq
MIRT852537	hsa-miR-4735-3p	CLIP-seq
MIRT852538	hsa-miR-4748	CLIP-seq
MIRT852539	hsa-miR-5047	CLIP-seq
MIRT852540	hsa-miR-657	CLIP-seq
MIRT852541	hsa-miR-1208	CLIP-seq
MIRT852542	hsa-miR-3173-3p	CLIP-seq
MIRT852543	hsa-miR-4722-3p	CLIP-seq
MIRT852544	hsa-miR-4769-3p	CLIP-seq
MIRT852545	hsa-miR-4779	CLIP-seq
MIRT1953008	hsa-miR-1182	CLIP-seq
MIRT1953009	hsa-miR-1207-5p	CLIP-seq
MIRT1953010	hsa-miR-124	CLIP-seq
MIRT1953011	hsa-miR-138	CLIP-seq
MIRT1953012	hsa-miR-1909	CLIP-seq
MIRT1953013	hsa-miR-2467-5p	CLIP-seq
MIRT1953014	hsa-miR-3144-5p	CLIP-seq
MIRT852542	hsa-miR-3173-3p	CLIP-seq
MIRT1953015	hsa-miR-3179	CLIP-seq
MIRT1953016	hsa-miR-3194-3p	CLIP-seq
MIRT1953017	hsa-miR-3202	CLIP-seq
MIRT1953018	hsa-miR-3907	CLIP-seq
MIRT1953019	hsa-miR-4299	CLIP-seq
MIRT1953020	hsa-miR-4456	CLIP-seq
MIRT1953021	hsa-miR-4493	CLIP-seq
MIRT1953022	hsa-miR-4514	CLIP-seq
MIRT1953023	hsa-miR-4692	CLIP-seq
MIRT852543	hsa-miR-4722-3p	CLIP-seq
MIRT1953024	hsa-miR-4724-5p	CLIP-seq
MIRT1953025	hsa-miR-4731-5p	CLIP-seq
MIRT1953026	hsa-miR-4737	CLIP-seq
MIRT1953027	hsa-miR-4747-5p	CLIP-seq
MIRT1953028	hsa-miR-4763-3p	CLIP-seq
MIRT852545	hsa-miR-4779	CLIP-seq
MIRT1953029	hsa-miR-506	CLIP-seq
MIRT1953030	hsa-miR-516b	CLIP-seq
MIRT1953031	hsa-miR-548q	CLIP-seq
MIRT1953032	hsa-miR-711	CLIP-seq
MIRT1953033	hsa-miR-760	CLIP-seq
MIRT1953034	hsa-miR-765	CLIP-seq
MIRT1953035	hsa-miR-940	CLIP-seq
MIRT2190824	hsa-miR-105	CLIP-seq
MIRT2190825	hsa-miR-1207-3p	CLIP-seq
MIRT852531	hsa-miR-1301	CLIP-seq
MIRT852532	hsa-miR-18a	CLIP-seq
MIRT852533	hsa-miR-18b	CLIP-seq
MIRT2190826	hsa-miR-1908	CLIP-seq
MIRT2190827	hsa-miR-216b	CLIP-seq
MIRT2190828	hsa-miR-3130-3p	CLIP-seq
MIRT2190829	hsa-miR-3189-5p	CLIP-seq
MIRT2190830	hsa-miR-338-3p	CLIP-seq
MIRT852534	hsa-miR-3665	CLIP-seq
MIRT2190831	hsa-miR-3671	CLIP-seq
MIRT2190832	hsa-miR-3675-3p	CLIP-seq
MIRT852535	hsa-miR-3937	CLIP-seq
MIRT2190833	hsa-miR-4454	CLIP-seq
MIRT852536	hsa-miR-4464	CLIP-seq
MIRT2190834	hsa-miR-4660	CLIP-seq
MIRT2190835	hsa-miR-4691-3p	CLIP-seq
MIRT2190836	hsa-miR-4716-3p	CLIP-seq
MIRT852537	hsa-miR-4735-3p	CLIP-seq
MIRT852538	hsa-miR-4748	CLIP-seq
MIRT2190837	hsa-miR-4758-3p	CLIP-seq
MIRT2190838	hsa-miR-4793-3p	CLIP-seq
MIRT852539	hsa-miR-5047	CLIP-seq
MIRT2190839	hsa-miR-544	CLIP-seq
MIRT2190840	hsa-miR-607	CLIP-seq
MIRT852540	hsa-miR-657	CLIP-seq
MIRT2190841	hsa-miR-663	CLIP-seq
MIRT1953034	hsa-miR-765	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005179	Function	Hormone activity	IDA	38503280
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	38503280
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	38503280
GO:0045540	Process	Regulation of cholesterol biosynthetic process	IDA	38503280
GO:0045541	Process	Negative regulation of cholesterol biosynthetic process	IDA	38503280
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	38503280

MIM	HGNC	e!Ensembl
621174	22421	ENSG00000146540

Q9BRJ6

Protein name

Protein cholesin

Protein function

Hormone secreted from the intestine in response to cholesterol, where it acts to inhibit cholesterol synthesis in the liver and VLDL secretion,leading to a reduction in circulating cholesterol levels. Acts through binding to its receptor, GPR146

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10180	WKF	104 → 166	WKF domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Secreted from the instestine, secretion is induced by feeding and cholesterol absorption. {ECO:0000269|PubMed:38503280}.

Sequence

MAKQKRKVPEVTEKKNKKLKKASAEGPLLGPEAAPSGEGAGSKGEAVLRPGLDAEPELSP
EEQRVLERKLKKERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQK
TRQTWLLLHMYDSDKVPDEHFSTLLAYLEGLQGRARELTVQKAEALMRELDEEGSDPPLP
GRAQRIRQVLQLLS

Sequence length

194

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE GASTRIC ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30107520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30107520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	35432200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	33100131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CHLSN (cholesin)