Gene Gene information from NCBI Gene database.
Entrez ID 84285
Gene name Eukaryotic translation initiation factor 1A domain containing
Gene symbol EIF1AD
Synonyms (NCBI Gene)
OBELIXhaponin
Chromosome 11
Chromosome location 11q13.1
miRNA miRNA information provided by mirtarbase database.
389
miRTarBase ID miRNA Experiments Reference
MIRT047654 hsa-miR-10a-5p CLASH 23622248
MIRT038809 hsa-miR-93-3p CLASH 23622248
MIRT037128 hsa-miR-877-3p CLASH 23622248
MIRT720282 hsa-miR-125b-5p HITS-CLIP 19536157
MIRT720281 hsa-miR-125a-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IEA
GO:0003743 Function Translation initiation factor activity IEA
GO:0005515 Function Protein binding IPI 16189514, 21516116, 25416956, 31515488, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618473 28147 ENSG00000175376
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N9N8
Protein name Probable RNA-binding protein EIF1AD (Eukaryotic translation initiation factor 1A domain-containing protein) (Haponin)
Protein function Plays a role into cellular response to oxidative stress. Decreases cell proliferation.
PDB 2DGY , 6ZXF , 6ZXG , 6ZXH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01176 eIF-1a 24 87 Translation initiation factor 1A / IF-1 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the glioblastoma cell line U-87MG, the embryonic kidney cell line HEK293, the pancreatic carcinoma cell line PANC-1, the breast carcinoma cell line MCF-7, the lung cancer cell line NCI-H460, and the chronic myelogenous leu
Sequence
MSQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKN
IWIKRGDFLIVDPIEEGEKVKAEISFV
LCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQT
QPELPAEPQLSGEESSSEDDSDLFVNTNRRQYHESEEESEEEEAA
Sequence length 165
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MELANOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
melanoma Melanoma CTD_human_DG 22535842
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum Colorectal Neoplasms BEFREE 26109816
★☆☆☆☆
Found in Text Mining only