RPAIN (RPA interacting protein)

Gene

• Entrez ID: 84268
• Gene name: RPA interacting protein
• Gene symbol: RPAIN
• Synonyms (NCBI Gene): HRIP, RIP
• Chromosome: 17
• Chromosome location: 17p13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT049637	hsa-miR-92a-3p	CLASH	23622248
MIRT048299	hsa-miR-107	CLASH	23622248
MIRT045476	hsa-miR-149-5p	CLASH	23622248
MIRT036588	hsa-miR-940	CLASH	23622248
MIRT1315459	hsa-miR-1200	CLIP-seq
MIRT1315460	hsa-miR-3140-5p	CLIP-seq
MIRT1315461	hsa-miR-4268	CLIP-seq
MIRT1315462	hsa-miR-4302	CLIP-seq
MIRT1315463	hsa-miR-4448	CLIP-seq
MIRT1315464	hsa-miR-4733-5p	CLIP-seq
MIRT1315465	hsa-miR-648	CLIP-seq
MIRT2093856	hsa-miR-2682	CLIP-seq
MIRT2093857	hsa-miR-299-5p	CLIP-seq
MIRT2093858	hsa-miR-3714	CLIP-seq
MIRT2093859	hsa-miR-4279	CLIP-seq
MIRT2093860	hsa-miR-449c	CLIP-seq
MIRT2093861	hsa-miR-4659a-3p	CLIP-seq
MIRT2093862	hsa-miR-4659b-3p	CLIP-seq
MIRT2093863	hsa-miR-4691-5p	CLIP-seq
MIRT2093861	hsa-miR-4659a-3p	CLIP-seq
MIRT2093862	hsa-miR-4659b-3p	CLIP-seq
MIRT2318359	hsa-miR-561	CLIP-seq
MIRT2393865	hsa-miR-2053	CLIP-seq
MIRT2393866	hsa-miR-4760-3p	CLIP-seq
MIRT2393867	hsa-miR-569	CLIP-seq
MIRT2393868	hsa-miR-664	CLIP-seq
MIRT2465989	hsa-miR-4773	CLIP-seq
MIRT2318359	hsa-miR-561	CLIP-seq
MIRT2614135	hsa-miR-219-1-3p	CLIP-seq
MIRT2614136	hsa-miR-4257	CLIP-seq
MIRT1315461	hsa-miR-4268	CLIP-seq
MIRT2093861	hsa-miR-4659a-3p	CLIP-seq
MIRT2093862	hsa-miR-4659b-3p	CLIP-seq
MIRT2614137	hsa-miR-4719	CLIP-seq
MIRT2465989	hsa-miR-4773	CLIP-seq
MIRT2614138	hsa-miR-511	CLIP-seq
MIRT2318359	hsa-miR-561	CLIP-seq
MIRT2614139	hsa-miR-571	CLIP-seq
MIRT2689914	hsa-miR-1202	CLIP-seq
MIRT2689915	hsa-miR-3126-3p	CLIP-seq
MIRT2689916	hsa-miR-3194-5p	CLIP-seq
MIRT2689917	hsa-miR-338-3p	CLIP-seq
MIRT2689918	hsa-miR-3667-3p	CLIP-seq
MIRT2689919	hsa-miR-3922-5p	CLIP-seq
MIRT2689920	hsa-miR-3972	CLIP-seq
MIRT2689921	hsa-miR-4796-3p	CLIP-seq
MIRT2689922	hsa-miR-548t	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	16135809
GO:0005737	Component	Cytoplasm	IEA
GO:0006606	Process	Protein import into nucleus	IBA
GO:0006606	Process	Protein import into nucleus	IDA	16135809
GO:0008270	Function	Zinc ion binding	IEA
GO:0009411	Process	Response to UV	IDA	16135809
GO:0016605	Component	PML body	IDA	16135809
GO:0016605	Component	PML body	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 617299
• HGNC: 28641
• e!Ensembl: ENSG00000129197

Protein

• UniProt ID: Q86UA6
• Protein name: RPA-interacting protein (hRIP)
• Protein function: Mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function i
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14766	RPA_interact_N	8 → 47	Replication protein A interacting N-terminal	Family
  PF14767	RPA_interact_M	59 → 127	Replication protein A interacting middle	Family
  PF14768	RPA_interact_C	136 → 217	Replication protein A interacting C-terminal	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed in pancreas, kidney, muscle, liver, lung, placenta, brain, heart, leukocytes, colon, intestine, ovary, testis, prostate, thymus and spleen. {ECO:0000269|PubMed:16008515}.
• Sequence:

  MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFL
  VQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDE
  KCLSIMLAEWEANPLICPVCTKYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSI
  NEHSAHCPHTPEFSVTGGTEEKSSLLMSCLACDTWAVIL

• Sequence length: 219

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	32755048	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17007882, 18641687, 20370918		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31212131		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31212131		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11166462		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29555502		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30983519		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31000693		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15240665, 17512546, 17615584, 28956297		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15240665, 17512546, 17615584, 28956297		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	17615584, 28861085, 29883690, 30623001, 31612266		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	19918773		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	25416676		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31819475		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11166462		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	33766078	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	17615584		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	14613923		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31330233		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20516030		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17007882, 18641687, 20370918		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25277242		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26261530		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17512546		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26516927, 26921446		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30455045		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31212131		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19632771		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29350287		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28295550		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	11166462		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31106003		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14613923, 17512546, 19401451, 29259007, 31672843		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	29259007		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30314898		★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	28978813		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	20370918		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29229388, 29859193, 31044561		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17512546		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	18253734		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26516927, 26921446		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31000693		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29021293		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29496522		★☆☆☆☆ Found in Text Mining only