Gene Gene information from NCBI Gene database.
Entrez ID 84259
Gene name Defective in cullin neddylation 1 domain containing 5
Gene symbol DCUN1D5
Synonyms (NCBI Gene)
DCNL5SCCRO5
Chromosome 11
Chromosome location 11q22.3
miRNA miRNA information provided by mirtarbase database.
667
miRTarBase ID miRNA Experiments Reference
MIRT022597 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT031628 hsa-miR-16-5p Proteomics 18668040
MIRT045545 hsa-miR-149-5p CLASH 23622248
MIRT704327 hsa-miR-4436b-3p HITS-CLIP 23313552
MIRT704326 hsa-miR-4632-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IBA
GO:0001558 Process Regulation of cell growth IMP 24192928
GO:0005515 Function Protein binding IPI 23201271, 24192928, 25416956, 26906416, 32296183, 32814053
GO:0005634 Component Nucleus IDA 18445686, 29958295
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616522 28409 ENSG00000137692
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BTE7
Protein name DCN1-like protein 5 (DCNL5) (DCUN1 domain-containing protein 5) (Defective in cullin neddylation protein 1-like protein 5) (Squamous cell carcinoma-related oncogene 5)
Protein function Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin l
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03556 Cullin_binding 120 230 Cullin binding Family
Tissue specificity TISSUE SPECIFICITY: Weakly expressed in testis, skin and immune tissues (thymus, spleen and lymph nodes). {ECO:0000269|PubMed:26906416}.
Sequence
MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAG
PDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEK
LQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVF
YQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEW
QKVRQTS
Sequence length 237
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARDIOVASCULAR DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 33918758 Associate
★☆☆☆☆
Found in Text Mining only
Cardiovascular Diseases Cardiovascular Diseases GWASCAT_DG 30595370
★☆☆☆☆
Found in Text Mining only
Laryngeal Squamous Cell Carcinoma Laryngeal Carcinoma BEFREE 23098533
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 24192928
★☆☆☆☆
Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck Squamous cell carcinoma Pubtator 23098533 Associate
★☆☆☆☆
Found in Text Mining only