RTL6 (retrotransposon Gag like 6)

Gene Gene information from NCBI Gene database.
Gene miRNA Other IDs Protein Associated diseases
Entrez ID 84247
Gene name Retrotransposon Gag like 6
Gene symbol RTL6
Synonyms (NCBI Gene)
LDOC1LMar6Mart6SIRH3dJ1033E15.2
Chromosome 22
Chromosome location 22q13.31
miRNA miRNA information provided by mirtarbase database.
58
Gene miRNA Other IDs Protein Associated diseases
Show/Hide all (58)
miRTarBase ID miRNA Experiments Reference
MIRT506747 hsa-miR-8485 PAR-CLIP 20371350
MIRT506746 hsa-miR-4789-3p PAR-CLIP 20371350
MIRT506748 hsa-miR-29a-3p PAR-CLIP 20371350
MIRT506750 hsa-miR-29b-3p PAR-CLIP 20371350
MIRT506749 hsa-miR-29c-3p PAR-CLIP 20371350
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
621006 13343 ENSG00000188636
Protein Protein information from UniProt database.
Gene miRNA Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ICC9
Protein name Retrotransposon Gag-like protein 6 (Leucine zipper protein down-regulated in cancer cells-like) (Mammalian retrotransposon-derived protein 6) (Protein LDOC1L)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16297 DUF4939 83 → 179 Domain of unknown function (DUF4939) Family
Sequence 
MVQPQTSKAESPALAASPNAQMDDVIDTLTSLRLTNSALRREASTLRAEKANLTNMLESV
MAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMD
RFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTYKSP
LRHARRAQIRKTSASNRAVRERQMLCRQLASAGTGPCPVHPASNGTSPAPALPARARNL
Sequence length 239
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANTI-GAD65 AUTOIMMUNE NEUROLOGICAL SYNDROMES — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Lupus Erythematosus Systemic Systemic lupus erythematosus Pubtator 21886837 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Partial Trisomy Trisomy BEFREE 10662811
★★★★★
★☆☆☆☆
Found in Text Mining only