Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84246
Gene name	Mediator complex subunit 10
Gene symbol	MED10
Synonyms (NCBI Gene)	L6NUT2TRG20
Chromosome	5
Chromosome location	5p15.31
Summary	MED10 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).[supplied by OMIM, Oct 2008]

134

Show/Hide all (134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023131	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT552137	hsa-miR-548a-3p	PAR-CLIP	21572407
MIRT552136	hsa-miR-548ar-3p	PAR-CLIP	21572407
MIRT552135	hsa-miR-548az-3p	PAR-CLIP	21572407
MIRT552134	hsa-miR-548e-3p	PAR-CLIP	21572407
MIRT552133	hsa-miR-548f-3p	PAR-CLIP	21572407
MIRT552132	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT313923	hsa-miR-543	PAR-CLIP	21572407
MIRT552131	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT552130	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT552129	hsa-miR-660-5p	PAR-CLIP	21572407
MIRT552128	hsa-miR-4773	PAR-CLIP	21572407
MIRT552127	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT552126	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT552125	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT552124	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT552123	hsa-miR-1279	PAR-CLIP	21572407
MIRT552122	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT552121	hsa-miR-567	PAR-CLIP	21572407
MIRT552120	hsa-miR-3613-5p	PAR-CLIP	21572407
MIRT552119	hsa-miR-3143	PAR-CLIP	21572407
MIRT552118	hsa-miR-4775	PAR-CLIP	21572407
MIRT552117	hsa-miR-5591-3p	PAR-CLIP	21572407
MIRT552116	hsa-miR-331-5p	PAR-CLIP	21572407
MIRT096862	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT552115	hsa-miR-6509-5p	PAR-CLIP	21572407
MIRT552137	hsa-miR-548a-3p	PAR-CLIP	21572407
MIRT552136	hsa-miR-548ar-3p	PAR-CLIP	21572407
MIRT552135	hsa-miR-548az-3p	PAR-CLIP	21572407
MIRT552134	hsa-miR-548e-3p	PAR-CLIP	21572407
MIRT552133	hsa-miR-548f-3p	PAR-CLIP	21572407
MIRT552132	hsa-miR-5582-3p	PAR-CLIP	21572407
MIRT313923	hsa-miR-543	PAR-CLIP	21572407
MIRT552131	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT552130	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT552129	hsa-miR-660-5p	PAR-CLIP	21572407
MIRT552128	hsa-miR-4773	PAR-CLIP	21572407
MIRT552127	hsa-miR-3927-3p	PAR-CLIP	21572407
MIRT552126	hsa-miR-6831-5p	PAR-CLIP	21572407
MIRT552125	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT552124	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT552123	hsa-miR-1279	PAR-CLIP	21572407
MIRT552122	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT552121	hsa-miR-567	PAR-CLIP	21572407
MIRT552120	hsa-miR-3613-5p	PAR-CLIP	21572407
MIRT552119	hsa-miR-3143	PAR-CLIP	21572407
MIRT552118	hsa-miR-4775	PAR-CLIP	21572407
MIRT552117	hsa-miR-5591-3p	PAR-CLIP	21572407
MIRT552116	hsa-miR-331-5p	PAR-CLIP	21572407
MIRT096862	hsa-miR-302c-5p	PAR-CLIP	21572407
MIRT552115	hsa-miR-6509-5p	PAR-CLIP	21572407
MIRT1140256	hsa-miR-1915	CLIP-seq
MIRT1140257	hsa-miR-203	CLIP-seq
MIRT1140258	hsa-miR-338-5p	CLIP-seq
MIRT1140259	hsa-miR-3647-3p	CLIP-seq
MIRT1140260	hsa-miR-369-3p	CLIP-seq
MIRT1140261	hsa-miR-374c	CLIP-seq
MIRT1140262	hsa-miR-4666-3p	CLIP-seq
MIRT1140263	hsa-miR-4726-3p	CLIP-seq
MIRT1140264	hsa-miR-491-3p	CLIP-seq
MIRT1140265	hsa-miR-501-3p	CLIP-seq
MIRT1140266	hsa-miR-502-3p	CLIP-seq
MIRT1140267	hsa-miR-570	CLIP-seq
MIRT1140268	hsa-miR-655	CLIP-seq
MIRT1140269	hsa-miR-935	CLIP-seq
MIRT2039722	hsa-miR-1224-3p	CLIP-seq
MIRT2039723	hsa-miR-1260	CLIP-seq
MIRT2039724	hsa-miR-1260b	CLIP-seq
MIRT2039725	hsa-miR-1280	CLIP-seq
MIRT2039726	hsa-miR-1539	CLIP-seq
MIRT1140256	hsa-miR-1915	CLIP-seq
MIRT2039727	hsa-miR-214	CLIP-seq
MIRT2039728	hsa-miR-3065-3p	CLIP-seq
MIRT2039729	hsa-miR-3074-5p	CLIP-seq
MIRT2039730	hsa-miR-3193	CLIP-seq
MIRT2039731	hsa-miR-3619-5p	CLIP-seq
MIRT2039732	hsa-miR-4279	CLIP-seq
MIRT2039733	hsa-miR-4291	CLIP-seq
MIRT2039734	hsa-miR-4476	CLIP-seq
MIRT2039735	hsa-miR-4691-5p	CLIP-seq
MIRT1140263	hsa-miR-4726-3p	CLIP-seq
MIRT2039736	hsa-miR-4746-5p	CLIP-seq
MIRT2039737	hsa-miR-4749-3p	CLIP-seq
MIRT2039738	hsa-miR-761	CLIP-seq
MIRT2039739	hsa-miR-766	CLIP-seq
MIRT2039740	hsa-miR-922	CLIP-seq
MIRT2039726	hsa-miR-1539	CLIP-seq
MIRT1140256	hsa-miR-1915	CLIP-seq
MIRT2039729	hsa-miR-3074-5p	CLIP-seq
MIRT2039730	hsa-miR-3193	CLIP-seq
MIRT2039732	hsa-miR-4279	CLIP-seq
MIRT2039735	hsa-miR-4691-5p	CLIP-seq
MIRT1140263	hsa-miR-4726-3p	CLIP-seq
MIRT2039736	hsa-miR-4746-5p	CLIP-seq
MIRT2039737	hsa-miR-4749-3p	CLIP-seq
MIRT2269525	hsa-miR-660	CLIP-seq
MIRT2039739	hsa-miR-766	CLIP-seq
MIRT2568834	hsa-miR-1207-3p	CLIP-seq
MIRT2568835	hsa-miR-1224-5p	CLIP-seq
MIRT2568836	hsa-miR-1287	CLIP-seq
MIRT2568837	hsa-miR-3135b	CLIP-seq
MIRT2568838	hsa-miR-3926	CLIP-seq
MIRT2039732	hsa-miR-4279	CLIP-seq
MIRT2039735	hsa-miR-4691-5p	CLIP-seq
MIRT2568839	hsa-miR-4731-5p	CLIP-seq
MIRT2039736	hsa-miR-4746-5p	CLIP-seq
MIRT2039737	hsa-miR-4749-3p	CLIP-seq
MIRT2568840	hsa-miR-4751	CLIP-seq
MIRT2568841	hsa-miR-486-3p	CLIP-seq
MIRT2039739	hsa-miR-766	CLIP-seq
MIRT2568834	hsa-miR-1207-3p	CLIP-seq
MIRT2568835	hsa-miR-1224-5p	CLIP-seq
MIRT2684776	hsa-miR-128	CLIP-seq
MIRT2568836	hsa-miR-1287	CLIP-seq
MIRT2684777	hsa-miR-198	CLIP-seq
MIRT2039728	hsa-miR-3065-3p	CLIP-seq
MIRT2568837	hsa-miR-3135b	CLIP-seq
MIRT2684778	hsa-miR-3184	CLIP-seq
MIRT2684779	hsa-miR-3650	CLIP-seq
MIRT2684780	hsa-miR-3657	CLIP-seq
MIRT2568838	hsa-miR-3926	CLIP-seq
MIRT2684781	hsa-miR-423-5p	CLIP-seq
MIRT2039732	hsa-miR-4279	CLIP-seq
MIRT2684782	hsa-miR-4286	CLIP-seq
MIRT2684783	hsa-miR-4455	CLIP-seq
MIRT2684784	hsa-miR-4656	CLIP-seq
MIRT2684785	hsa-miR-4669	CLIP-seq
MIRT2039735	hsa-miR-4691-5p	CLIP-seq
MIRT2568839	hsa-miR-4731-5p	CLIP-seq
MIRT2039736	hsa-miR-4746-5p	CLIP-seq
MIRT2039737	hsa-miR-4749-3p	CLIP-seq
MIRT2568840	hsa-miR-4751	CLIP-seq
MIRT2568841	hsa-miR-486-3p	CLIP-seq
MIRT2039739	hsa-miR-766	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005515	Function	Protein binding	IPI	14576168, 15175163, 24882805, 24981860, 28514442, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	24882805
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016592	Component	Mediator complex	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	NAS	11559591
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	NAS	11559591
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	NAS	11559591
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070847	Component	Core mediator complex	IPI	24882805

MIM	HGNC	e!Ensembl
612382	28760	ENSG00000133398

Q9BTT4

Protein name

Mediator of RNA polymerase II transcription subunit 10 (Mediator complex subunit 10) (Transformation-related gene 17 protein) (TRG-17) (Transformation-related gene 20 protein) (TRG-20)

Protein function

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN

PDB

7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 7NVR , 8GXQ , 8GXS , 8T9D , 8TQW , 8TRH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09748	Med10	9 → 126	Transcription factor subunit Med10 of Mediator complex	Family

Sequence

MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHD
ITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPED
MAKYRSIRGEDHPPS

Sequence length

135

Interactions

View interactions

	Reactome
			PPARA activates gene expression Generic Transcription Pathway Transcriptional regulation of white adipocyte differentiation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33579192, 35069777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30382873, 40594722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MED10 (mediator complex subunit 10)