Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84223
Gene name	Dynein regulatory complex subunit 9
Gene symbol	DRC9
Synonyms (NCBI Gene)	CFAP122IQCG
Chromosome	3
Chromosome location	3q29

Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019420	hsa-miR-148b-3p	Microarray	17612493
MIRT025135	hsa-miR-181a-5p	Microarray	17612493
MIRT442472	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT025135	hsa-miR-181a-5p	PAR-CLIP	22100165
MIRT442471	hsa-miR-181b-5p	PAR-CLIP	22100165
MIRT442470	hsa-miR-181c-5p	PAR-CLIP	22100165
MIRT442469	hsa-miR-181d-5p	PAR-CLIP	22100165
MIRT442468	hsa-miR-4262	PAR-CLIP	22100165
MIRT442467	hsa-miR-3671	PAR-CLIP	22100165
MIRT442466	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT442465	hsa-miR-607	PAR-CLIP	22100165
MIRT442472	hsa-miR-548e-5p	PAR-CLIP	22100165
MIRT025135	hsa-miR-181a-5p	PAR-CLIP	22100165
MIRT442471	hsa-miR-181b-5p	PAR-CLIP	22100165
MIRT442470	hsa-miR-181c-5p	PAR-CLIP	22100165
MIRT442469	hsa-miR-181d-5p	PAR-CLIP	22100165
MIRT442468	hsa-miR-4262	PAR-CLIP	22100165
MIRT442467	hsa-miR-3671	PAR-CLIP	22100165
MIRT442466	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT442465	hsa-miR-607	PAR-CLIP	22100165
MIRT2017149	hsa-miR-1225-5p	CLIP-seq
MIRT2017150	hsa-miR-5096	CLIP-seq
MIRT2017151	hsa-miR-555	CLIP-seq
MIRT2249110	hsa-miR-3153	CLIP-seq
MIRT2249111	hsa-miR-3155	CLIP-seq
MIRT2249112	hsa-miR-3155b	CLIP-seq
MIRT2249113	hsa-miR-3935	CLIP-seq
MIRT2249114	hsa-miR-4261	CLIP-seq
MIRT2249115	hsa-miR-4292	CLIP-seq
MIRT2249116	hsa-miR-4308	CLIP-seq
MIRT2249117	hsa-miR-4496	CLIP-seq
MIRT2249118	hsa-miR-4646-5p	CLIP-seq
MIRT2249119	hsa-miR-4668-5p	CLIP-seq
MIRT2249120	hsa-miR-484	CLIP-seq
MIRT2249121	hsa-miR-649	CLIP-seq
MIRT2249122	hsa-miR-670	CLIP-seq
MIRT2451913	hsa-miR-1276	CLIP-seq
MIRT2451914	hsa-miR-4251	CLIP-seq
MIRT2451915	hsa-miR-451b	CLIP-seq
MIRT2451916	hsa-miR-4663	CLIP-seq
MIRT2451917	hsa-miR-539	CLIP-seq
MIRT2552692	hsa-miR-1183	CLIP-seq
MIRT2552693	hsa-miR-1208	CLIP-seq
MIRT2451913	hsa-miR-1276	CLIP-seq
MIRT2552694	hsa-miR-3121-5p	CLIP-seq
MIRT2552695	hsa-miR-3137	CLIP-seq
MIRT2552696	hsa-miR-323-3p	CLIP-seq
MIRT2552697	hsa-miR-375	CLIP-seq
MIRT2451914	hsa-miR-4251	CLIP-seq
MIRT2552698	hsa-miR-4273	CLIP-seq
MIRT2451915	hsa-miR-451b	CLIP-seq
MIRT2451916	hsa-miR-4663	CLIP-seq
MIRT2552699	hsa-miR-4676-5p	CLIP-seq
MIRT2552700	hsa-miR-4677-5p	CLIP-seq
MIRT2552701	hsa-miR-4680-5p	CLIP-seq
MIRT2552702	hsa-miR-4700-3p	CLIP-seq
MIRT2552703	hsa-miR-5095	CLIP-seq
MIRT2451917	hsa-miR-539	CLIP-seq
MIRT2552704	hsa-miR-575	CLIP-seq
MIRT2552705	hsa-miR-888	CLIP-seq
MIRT2552692	hsa-miR-1183	CLIP-seq
MIRT2552693	hsa-miR-1208	CLIP-seq
MIRT2451913	hsa-miR-1276	CLIP-seq
MIRT2552694	hsa-miR-3121-5p	CLIP-seq
MIRT2552695	hsa-miR-3137	CLIP-seq
MIRT2552696	hsa-miR-323-3p	CLIP-seq
MIRT2552697	hsa-miR-375	CLIP-seq
MIRT2451914	hsa-miR-4251	CLIP-seq
MIRT2552698	hsa-miR-4273	CLIP-seq
MIRT2451915	hsa-miR-451b	CLIP-seq
MIRT2451916	hsa-miR-4663	CLIP-seq
MIRT2552699	hsa-miR-4676-5p	CLIP-seq
MIRT2552700	hsa-miR-4677-5p	CLIP-seq
MIRT2552701	hsa-miR-4680-5p	CLIP-seq
MIRT2552702	hsa-miR-4700-3p	CLIP-seq
MIRT2552703	hsa-miR-5095	CLIP-seq
MIRT2451917	hsa-miR-539	CLIP-seq
MIRT2552704	hsa-miR-575	CLIP-seq
MIRT2552705	hsa-miR-888	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002177	Component	Manchette	IEA
GO:0002177	Component	Manchette	ISS
GO:0005516	Function	Calmodulin binding	IDA	24787902
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	24787902
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0007286	Process	Spermatid development	ISS
GO:0007288	Process	Sperm axoneme assembly	IBA
GO:0007288	Process	Sperm axoneme assembly	IEA
GO:0007288	Process	Sperm axoneme assembly	ISS
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0030154	Process	Cell differentiation	IEA
GO:0030544	Function	Hsp70 protein binding	IPI	24787902
GO:0031514	Component	Motile cilium	IEA
GO:0031514	Component	Motile cilium	ISS
GO:0036126	Component	Sperm flagellum	IBA
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0044782	Process	Cilium organization	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
612477	25251	ENSG00000114473

Q9H095

Protein name

Dynein regulatory complex protein 9 (IQ domain-containing protein G)

Protein function

Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. Binds calmodulin when

PDB

4LZX , 4M1L , 8J07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00612	IQ	394 → 413	IQ calmodulin-binding motif	Motif

Sequence

MEEDSLEDSNLPPKVWHSEMTVSVTGEPPSTVEEEGIPKETDIEIIPEIPETLEPLSLPD
VLRISAVLEDTTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPS
PLITEEGPNLPEIRHRGRFAVEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIA
DTIKELQDSATYNSLLQALSKERENKMHFYDIIAREEKGRKQIISLQKQLINVKKEWQFE
VQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQTQKKCNRTEELLVEEIEKLRM
KTEEEARTHTEIEMFLRKEQQKLEERLEFWMEKYDKDTEMKQNELNALKATKASDLAHLQ
DLAKMIREYEQVIIEDRIEKERSKKKVKQDLLELKSVIKLQAWWRGTMIRREIGGFKMPK
DKVDSKDSKGKGKGKDKRRGKKK

Sequence length

443

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANEMIA, DIAMOND-BLACKFAN	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIAMOND-BLACKFAN ANEMIA 5	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia, Diamond-Blackfan	Anemia	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Ductal	Ductal carcinoma	Pubtator	28717182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diamond-Blackfan Anemia 5	Diamond-Blackfan anemia	CLINVAR_DG	18535205, 25946618		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloid Leukemia	Myeloid Leukemia	BEFREE	18084320		★★★★★ ★☆☆☆☆ Found in Text Mining only

DRC9 (dynein regulatory complex subunit 9)