Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84193
Gene name	SET domain containing 3, actin N3(tau)-histidine methyltransferase
Gene symbol	SETD3
Synonyms (NCBI Gene)	C14orf154hSETD3
Chromosome	14
Chromosome location	14q32.2

202

Show/Hide all (202)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025247	hsa-miR-34a-5p	Proteomics	21566225
MIRT025247	hsa-miR-34a-5p	Proteomics	21566225
MIRT044857	hsa-miR-320a	CLASH	23622248
MIRT468407	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT468406	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT468405	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT468404	hsa-miR-6730-3p	PAR-CLIP	23592263
MIRT468403	hsa-miR-642a-3p	PAR-CLIP	23592263
MIRT468402	hsa-miR-642b-3p	PAR-CLIP	23592263
MIRT468401	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT468400	hsa-miR-558	PAR-CLIP	23592263
MIRT468399	hsa-miR-4487	PAR-CLIP	23592263
MIRT468398	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT468397	hsa-miR-4252	PAR-CLIP	23592263
MIRT468396	hsa-miR-1227-3p	PAR-CLIP	23592263
MIRT468395	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT468394	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT726621	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT726619	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT726620	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT726618	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT726617	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT468407	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT468406	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT468405	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT468404	hsa-miR-6730-3p	PAR-CLIP	23592263
MIRT468403	hsa-miR-642a-3p	PAR-CLIP	23592263
MIRT468402	hsa-miR-642b-3p	PAR-CLIP	23592263
MIRT468401	hsa-miR-3160-3p	PAR-CLIP	23592263
MIRT468400	hsa-miR-558	PAR-CLIP	23592263
MIRT468399	hsa-miR-4487	PAR-CLIP	23592263
MIRT468398	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT468397	hsa-miR-4252	PAR-CLIP	23592263
MIRT468396	hsa-miR-1227-3p	PAR-CLIP	23592263
MIRT468395	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT468394	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT1340114	hsa-miR-1243	CLIP-seq
MIRT1340115	hsa-miR-1976	CLIP-seq
MIRT1340116	hsa-miR-3064-3p	CLIP-seq
MIRT1340117	hsa-miR-342-5p	CLIP-seq
MIRT1340118	hsa-miR-34b	CLIP-seq
MIRT1340119	hsa-miR-34c-3p	CLIP-seq
MIRT1340120	hsa-miR-361-3p	CLIP-seq
MIRT1340121	hsa-miR-370	CLIP-seq
MIRT1340122	hsa-miR-4506	CLIP-seq
MIRT1340123	hsa-miR-4651	CLIP-seq
MIRT1340124	hsa-miR-4664-5p	CLIP-seq
MIRT1340125	hsa-miR-4694-5p	CLIP-seq
MIRT1340126	hsa-miR-4715-3p	CLIP-seq
MIRT1340127	hsa-miR-4724-3p	CLIP-seq
MIRT1340128	hsa-miR-548aa	CLIP-seq
MIRT1340129	hsa-miR-548ac	CLIP-seq
MIRT1340130	hsa-miR-548d-3p	CLIP-seq
MIRT1340131	hsa-miR-548z	CLIP-seq
MIRT1340132	hsa-miR-608	CLIP-seq
MIRT1340133	hsa-miR-609	CLIP-seq
MIRT1340134	hsa-miR-1255a	CLIP-seq
MIRT1340135	hsa-miR-1255b	CLIP-seq
MIRT1340136	hsa-miR-3119	CLIP-seq
MIRT1340137	hsa-miR-3141	CLIP-seq
MIRT1340138	hsa-miR-3675-5p	CLIP-seq
MIRT1340139	hsa-miR-4283	CLIP-seq
MIRT1340140	hsa-miR-4436a	CLIP-seq
MIRT1340141	hsa-miR-4436b-3p	CLIP-seq
MIRT1340142	hsa-miR-4459	CLIP-seq
MIRT1340143	hsa-miR-4489	CLIP-seq
MIRT1340144	hsa-miR-4699-3p	CLIP-seq
MIRT1340145	hsa-miR-4722-5p	CLIP-seq
MIRT1340146	hsa-miR-4729	CLIP-seq
MIRT1340147	hsa-miR-4779	CLIP-seq
MIRT1340148	hsa-miR-582-5p	CLIP-seq
MIRT2100510	hsa-miR-19a	CLIP-seq
MIRT2100511	hsa-miR-19b	CLIP-seq
MIRT2100512	hsa-miR-2053	CLIP-seq
MIRT1340117	hsa-miR-342-5p	CLIP-seq
MIRT1340118	hsa-miR-34b	CLIP-seq
MIRT1340119	hsa-miR-34c-3p	CLIP-seq
MIRT2100513	hsa-miR-3613-3p	CLIP-seq
MIRT2100514	hsa-miR-410	CLIP-seq
MIRT2100515	hsa-miR-4426	CLIP-seq
MIRT1340122	hsa-miR-4506	CLIP-seq
MIRT2100516	hsa-miR-451b	CLIP-seq
MIRT2100517	hsa-miR-4647	CLIP-seq
MIRT1340123	hsa-miR-4651	CLIP-seq
MIRT2100518	hsa-miR-4652-3p	CLIP-seq
MIRT2100519	hsa-miR-4662b	CLIP-seq
MIRT1340124	hsa-miR-4664-5p	CLIP-seq
MIRT1340126	hsa-miR-4715-3p	CLIP-seq
MIRT1340127	hsa-miR-4724-3p	CLIP-seq
MIRT2100520	hsa-miR-4774-3p	CLIP-seq
MIRT2100521	hsa-miR-544	CLIP-seq
MIRT2100522	hsa-miR-548n	CLIP-seq
MIRT2100523	hsa-miR-569	CLIP-seq
MIRT1340132	hsa-miR-608	CLIP-seq
MIRT2100524	hsa-miR-891b	CLIP-seq
MIRT1340134	hsa-miR-1255a	CLIP-seq
MIRT1340135	hsa-miR-1255b	CLIP-seq
MIRT2100525	hsa-miR-556-5p	CLIP-seq
MIRT2325228	hsa-miR-2355-5p	CLIP-seq
MIRT1340128	hsa-miR-548aa	CLIP-seq
MIRT1340129	hsa-miR-548ac	CLIP-seq
MIRT1340130	hsa-miR-548d-3p	CLIP-seq
MIRT1340131	hsa-miR-548z	CLIP-seq
MIRT2325229	hsa-miR-887	CLIP-seq
MIRT1340134	hsa-miR-1255a	CLIP-seq
MIRT1340135	hsa-miR-1255b	CLIP-seq
MIRT2394254	hsa-miR-3135b	CLIP-seq
MIRT2394255	hsa-miR-3612	CLIP-seq
MIRT2394256	hsa-miR-4443	CLIP-seq
MIRT2100525	hsa-miR-556-5p	CLIP-seq
MIRT2394257	hsa-miR-650	CLIP-seq
MIRT2620927	hsa-miR-105	CLIP-seq
MIRT2620928	hsa-miR-1273g	CLIP-seq
MIRT2620929	hsa-miR-127-5p	CLIP-seq
MIRT2620930	hsa-miR-136	CLIP-seq
MIRT2620931	hsa-miR-139-3p	CLIP-seq
MIRT2620932	hsa-miR-150	CLIP-seq
MIRT2620933	hsa-miR-188-3p	CLIP-seq
MIRT2620934	hsa-miR-204	CLIP-seq
MIRT2620935	hsa-miR-2052	CLIP-seq
MIRT2100512	hsa-miR-2053	CLIP-seq
MIRT2620936	hsa-miR-211	CLIP-seq
MIRT2620937	hsa-miR-2276	CLIP-seq
MIRT2325228	hsa-miR-2355-5p	CLIP-seq
MIRT2620938	hsa-miR-3152-5p	CLIP-seq
MIRT2620939	hsa-miR-323b-5p	CLIP-seq
MIRT2100513	hsa-miR-3613-3p	CLIP-seq
MIRT2620940	hsa-miR-3652	CLIP-seq
MIRT2620941	hsa-miR-4265	CLIP-seq
MIRT2620942	hsa-miR-4266	CLIP-seq
MIRT2620943	hsa-miR-4269	CLIP-seq
MIRT2620944	hsa-miR-4282	CLIP-seq
MIRT2620945	hsa-miR-4287	CLIP-seq
MIRT2620946	hsa-miR-4296	CLIP-seq
MIRT2620947	hsa-miR-4322	CLIP-seq
MIRT2620948	hsa-miR-4417	CLIP-seq
MIRT2100515	hsa-miR-4426	CLIP-seq
MIRT2620949	hsa-miR-4430	CLIP-seq
MIRT2620950	hsa-miR-4452	CLIP-seq
MIRT2620951	hsa-miR-4469	CLIP-seq
MIRT2620952	hsa-miR-4471	CLIP-seq
MIRT2620953	hsa-miR-450b-5p	CLIP-seq
MIRT2100516	hsa-miR-451b	CLIP-seq
MIRT2620954	hsa-miR-4527	CLIP-seq
MIRT2100517	hsa-miR-4647	CLIP-seq
MIRT2100519	hsa-miR-4662b	CLIP-seq
MIRT2620955	hsa-miR-4668-3p	CLIP-seq
MIRT2620956	hsa-miR-4680-3p	CLIP-seq
MIRT2620957	hsa-miR-4681	CLIP-seq
MIRT2620958	hsa-miR-4685-3p	CLIP-seq
MIRT2620959	hsa-miR-4695-5p	CLIP-seq
MIRT2620960	hsa-miR-4713-5p	CLIP-seq
MIRT2620961	hsa-miR-4772-3p	CLIP-seq
MIRT2100520	hsa-miR-4774-3p	CLIP-seq
MIRT1340147	hsa-miR-4779	CLIP-seq
MIRT2620962	hsa-miR-483-5p	CLIP-seq
MIRT2620963	hsa-miR-501-3p	CLIP-seq
MIRT2620964	hsa-miR-502-3p	CLIP-seq
MIRT2620965	hsa-miR-518a-5p	CLIP-seq
MIRT2620966	hsa-miR-527	CLIP-seq
MIRT2620967	hsa-miR-532-3p	CLIP-seq
MIRT2100523	hsa-miR-569	CLIP-seq
MIRT2620968	hsa-miR-578	CLIP-seq
MIRT2620969	hsa-miR-581	CLIP-seq
MIRT2620970	hsa-miR-767-5p	CLIP-seq
MIRT2620971	hsa-miR-885-5p	CLIP-seq
MIRT2620972	hsa-miR-942	CLIP-seq
MIRT2620928	hsa-miR-1273g	CLIP-seq
MIRT2620931	hsa-miR-139-3p	CLIP-seq
MIRT2620932	hsa-miR-150	CLIP-seq
MIRT2620933	hsa-miR-188-3p	CLIP-seq
MIRT2620934	hsa-miR-204	CLIP-seq
MIRT2620935	hsa-miR-2052	CLIP-seq
MIRT2100512	hsa-miR-2053	CLIP-seq
MIRT2620936	hsa-miR-211	CLIP-seq
MIRT2620937	hsa-miR-2276	CLIP-seq
MIRT2325228	hsa-miR-2355-5p	CLIP-seq
MIRT2620938	hsa-miR-3152-5p	CLIP-seq
MIRT2620939	hsa-miR-323b-5p	CLIP-seq
MIRT2100513	hsa-miR-3613-3p	CLIP-seq
MIRT2620943	hsa-miR-4269	CLIP-seq
MIRT2620945	hsa-miR-4287	CLIP-seq
MIRT2100515	hsa-miR-4426	CLIP-seq
MIRT2620950	hsa-miR-4452	CLIP-seq
MIRT2620951	hsa-miR-4469	CLIP-seq
MIRT2620952	hsa-miR-4471	CLIP-seq
MIRT2100516	hsa-miR-451b	CLIP-seq
MIRT2620954	hsa-miR-4527	CLIP-seq
MIRT2100517	hsa-miR-4647	CLIP-seq
MIRT2100519	hsa-miR-4662b	CLIP-seq
MIRT2620956	hsa-miR-4680-3p	CLIP-seq
MIRT2620957	hsa-miR-4681	CLIP-seq
MIRT2620958	hsa-miR-4685-3p	CLIP-seq
MIRT2620960	hsa-miR-4713-5p	CLIP-seq
MIRT2620961	hsa-miR-4772-3p	CLIP-seq
MIRT2100520	hsa-miR-4774-3p	CLIP-seq
MIRT2620962	hsa-miR-483-5p	CLIP-seq
MIRT2620967	hsa-miR-532-3p	CLIP-seq
MIRT2100523	hsa-miR-569	CLIP-seq
MIRT2620968	hsa-miR-578	CLIP-seq
MIRT2620969	hsa-miR-581	CLIP-seq
MIRT2620972	hsa-miR-942	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	26030842
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	30626964
GO:0005737	Component	Cytoplasm	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0016279	Function	Protein-lysine N-methyltransferase activity	IDA	30785395
GO:0016740	Function	Transferase activity	IEA
GO:0018021	Process	Peptidyl-histidine methylation	IDA	30526847, 30626964, 30785395, 31388018, 31993215
GO:0018023	Process	Peptidyl-lysine trimethylation	IDA	30785395
GO:0018064	Function	Protein-L-histidine N-tele-methyltransferase activity	IBA
GO:0018064	Function	Protein-L-histidine N-tele-methyltransferase activity	IDA	30526847, 30626964, 30785395, 31388018, 31993215
GO:0018064	Function	Protein-L-histidine N-tele-methyltransferase activity	IEA
GO:0030047	Process	Actin modification	IDA	30526847, 30626964, 30785395, 31388018, 31993215
GO:0032259	Process	Methylation	IEA
GO:0042800	Function	Histone H3K4 methyltransferase activity	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046975	Function	Histone H3K36 methyltransferase activity	IBA
GO:0046975	Function	Histone H3K36 methyltransferase activity	ISS
GO:0051149	Process	Positive regulation of muscle cell differentiation	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0070472	Process	Regulation of uterine smooth muscle contraction	IBA
GO:0070472	Process	Regulation of uterine smooth muscle contraction	IEA
GO:0070472	Process	Regulation of uterine smooth muscle contraction	ISS

MIM	HGNC	e!Ensembl
615671	20493	ENSG00000183576

Q86TU7

Protein name

Actin-histidine N-methyltransferase (EC 2.1.1.85) (Protein-L-histidine N-tele-methyltransferase) (SET domain-containing protein 3) (hSETD3)

Protein function

Protein-histidine N-methyltransferase that specifically mediates 3-methylhistidine (tele-methylhistidine) methylation of actin at 'His-73' (PubMed:30526847, PubMed:30626964, PubMed:30785395, PubMed:31388018, PubMed:31993215). Histidine methylati

PDB

3SMT , 6ICT , 6ICV , 6JAT , 6MBJ , 6MBK , 6MBL , 6OX0 , 6OX1 , 6OX2 , 6OX3 , 6OX4 , 6OX5 , 6V62 , 6V63 , 6WK1 , 6WK2 , 7LMS , 7W28 , 7W29 , 8X77 , 8X8Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00856	SET	105 → 314	SET domain	Family
PF09273	Rubis-subs-bind	345 → 475	Rubisco LSMT substrate-binding	Domain

Sequence

MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKI
RKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELF
LWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLP
SEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFT
YEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVAL
QDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAEVLARA
GIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVSW
DNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVK
SAAVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLPLVLRNLEEEAGVQDALNIRE
AISKAKATENGLVNGENSIPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE

Sequence length

594

Interactions

View interactions

	Reactome
			PKMTs methylate histone lysines

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23065515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32042016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32042016, 35018513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35018513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26488939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35435120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30683849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29099276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	31527793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29950684, 30785395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31190319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24441149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31654063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28442573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34288821	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23065515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28442573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28442573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35196205	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26488939, 28442573		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31527793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31190319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30984543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34288821	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

SETD3 (SET domain containing 3, actin N3(tau)-histidine methyltransferase)