Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84186
Gene name	Zinc finger CCHC-type containing 7
Gene symbol	ZCCHC7
Synonyms (NCBI Gene)	AIR1HSPC086
Chromosome	9
Chromosome location	9p13.2

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044027	hsa-miR-365a-3p	CLASH	23622248
MIRT439245	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439245	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT1507421	hsa-miR-1272	CLIP-seq
MIRT1507422	hsa-miR-127-5p	CLIP-seq
MIRT1507423	hsa-miR-3127-5p	CLIP-seq
MIRT1507424	hsa-miR-3158-3p	CLIP-seq
MIRT1507425	hsa-miR-3918	CLIP-seq
MIRT1507426	hsa-miR-3938	CLIP-seq
MIRT1507427	hsa-miR-425	CLIP-seq
MIRT1507428	hsa-miR-628-5p	CLIP-seq
MIRT1507429	hsa-miR-670	CLIP-seq
MIRT2152847	hsa-miR-3660	CLIP-seq
MIRT2152848	hsa-miR-3973	CLIP-seq
MIRT2152849	hsa-miR-4256	CLIP-seq
MIRT2152850	hsa-miR-4526	CLIP-seq
MIRT2152851	hsa-miR-4699-5p	CLIP-seq
MIRT2152852	hsa-miR-549	CLIP-seq
MIRT2152853	hsa-miR-578	CLIP-seq
MIRT2373198	hsa-miR-128	CLIP-seq
MIRT2373199	hsa-miR-154	CLIP-seq
MIRT2373200	hsa-miR-3646	CLIP-seq
MIRT2152847	hsa-miR-3660	CLIP-seq
MIRT2373201	hsa-miR-3926	CLIP-seq
MIRT2152850	hsa-miR-4526	CLIP-seq
MIRT2373202	hsa-miR-4753-5p	CLIP-seq
MIRT2152852	hsa-miR-549	CLIP-seq
MIRT2666048	hsa-miR-1243	CLIP-seq
MIRT2666049	hsa-miR-1245	CLIP-seq
MIRT2666050	hsa-miR-1253	CLIP-seq
MIRT1507422	hsa-miR-127-5p	CLIP-seq
MIRT2373199	hsa-miR-154	CLIP-seq
MIRT2666051	hsa-miR-2052	CLIP-seq
MIRT2666052	hsa-miR-2355-3p	CLIP-seq
MIRT2666053	hsa-miR-3074-5p	CLIP-seq
MIRT2666054	hsa-miR-3117-5p	CLIP-seq
MIRT1507423	hsa-miR-3127-5p	CLIP-seq
MIRT1507424	hsa-miR-3158-3p	CLIP-seq
MIRT2666055	hsa-miR-3168	CLIP-seq
MIRT2666056	hsa-miR-3613-3p	CLIP-seq
MIRT2666057	hsa-miR-3654	CLIP-seq
MIRT1507425	hsa-miR-3918	CLIP-seq
MIRT2666058	hsa-miR-3925-5p	CLIP-seq
MIRT1507426	hsa-miR-3938	CLIP-seq
MIRT2666059	hsa-miR-4307	CLIP-seq
MIRT2666060	hsa-miR-4645-3p	CLIP-seq
MIRT2666061	hsa-miR-4646-3p	CLIP-seq
MIRT2666062	hsa-miR-4696	CLIP-seq
MIRT2152851	hsa-miR-4699-5p	CLIP-seq
MIRT2666063	hsa-miR-4703-3p	CLIP-seq
MIRT2666064	hsa-miR-4712-3p	CLIP-seq
MIRT2666065	hsa-miR-4729	CLIP-seq
MIRT2666066	hsa-miR-4742-3p	CLIP-seq
MIRT2666067	hsa-miR-486-5p	CLIP-seq
MIRT2666068	hsa-miR-494	CLIP-seq
MIRT2666069	hsa-miR-548c-3p	CLIP-seq
MIRT1507428	hsa-miR-628-5p	CLIP-seq
MIRT1507429	hsa-miR-670	CLIP-seq
MIRT2666048	hsa-miR-1243	CLIP-seq
MIRT2666050	hsa-miR-1253	CLIP-seq
MIRT1507422	hsa-miR-127-5p	CLIP-seq
MIRT2373199	hsa-miR-154	CLIP-seq
MIRT2666053	hsa-miR-3074-5p	CLIP-seq
MIRT2666055	hsa-miR-3168	CLIP-seq
MIRT2666056	hsa-miR-3613-3p	CLIP-seq
MIRT2666057	hsa-miR-3654	CLIP-seq
MIRT2666058	hsa-miR-3925-5p	CLIP-seq
MIRT2666062	hsa-miR-4696	CLIP-seq
MIRT2666063	hsa-miR-4703-3p	CLIP-seq
MIRT2666064	hsa-miR-4712-3p	CLIP-seq
MIRT2666065	hsa-miR-4729	CLIP-seq
MIRT2666066	hsa-miR-4742-3p	CLIP-seq
MIRT2666067	hsa-miR-486-5p	CLIP-seq
MIRT2666069	hsa-miR-548c-3p	CLIP-seq
MIRT1507428	hsa-miR-628-5p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 25556234, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0031499	Component	TRAMP complex	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0071031	Process	Nuclear mRNA surveillance of mRNA 3'-end processing	IBA
GO:0071035	Process	Nuclear polyadenylation-dependent rRNA catabolic process	IBA
GO:0071036	Process	Nuclear polyadenylation-dependent snoRNA catabolic process	IBA
GO:0071037	Process	Nuclear polyadenylation-dependent snRNA catabolic process	IBA
GO:0071038	Process	TRAMP-dependent tRNA surveillance pathway	IBA
GO:0071039	Process	Nuclear polyadenylation-dependent CUT catabolic process	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8N3Z6

Protein name

Zinc finger CCHC domain-containing protein 7 (TRAMP-like complex RNA-binding factor ZCCHC7)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00098	zf-CCHC	241 → 258	Zinc knuckle	Domain

Sequence

MMFGGYETIEAYEDDLYRDESSSELSVDSEVEFQLYSQIHYAQDLDDVIREEEHEEKNSG
NSESSSSKPNQKKLIVLSDSEVIQLSDGSEVITLSDEDSIYRCKGKNVRVQAQENAHGLS
SSLQSNELVDKKCKSDIEKPKSEERSGVIREVMIIEVSSSEEEESTISEGDNVESWMLLG
CEVDDKDDDILLNLVGCENSVTEGEDGINWSISDKDIEAQIANNRTPGRWTQRYYSANKN
IICRNCDKRGHLSKNCPLPRKVRRCFLCSRRGHLLYSCPAPLCEYCPVPKMLDHSCLFRH
SWDKQCDRCHMLGHYTDACTEIWRQYHLTTKPGPPKKPKTPSRPSALAYCYHCAQKGHYG
HECPEREVYDPSPVSPFICYYDDKYEIQEREKRLKQKIKVLKKNGVIPEPSKLPYIKAAN
ENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTY
SSPGSFKTQKPSKPFHRSSHYHTSREDKSPKEGKRGKQKKKERCWEDDDNDNLFLIKQRK
KKS

Sequence length

543

Interactions

View interactions

	KEGG
	RNA degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPHYXIA NEONATORUM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28476192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28476192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10825588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28476192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10825588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	38049665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	33878706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZCCHC7 (zinc finger CCHC-type containing 7)