Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84174
Gene name	Src like adaptor 2
Gene symbol	SLA2
Synonyms (NCBI Gene)	C20orf156MARSSLAP-2SLAP2
Chromosome	20
Chromosome location	20q11.23
Summary	This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein

204

Show/Hide all (204)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018729	hsa-miR-335-5p	Microarray	18185580
MIRT1351311	hsa-miR-1228	CLIP-seq
MIRT1351312	hsa-miR-1273f	CLIP-seq
MIRT1351313	hsa-miR-1276	CLIP-seq
MIRT1351314	hsa-miR-1293	CLIP-seq
MIRT1351315	hsa-miR-24	CLIP-seq
MIRT1351316	hsa-miR-31	CLIP-seq
MIRT1351317	hsa-miR-3122	CLIP-seq
MIRT1351318	hsa-miR-3160-3p	CLIP-seq
MIRT1351319	hsa-miR-3165	CLIP-seq
MIRT1351320	hsa-miR-342-3p	CLIP-seq
MIRT1351321	hsa-miR-3613-3p	CLIP-seq
MIRT1351322	hsa-miR-3622a-3p	CLIP-seq
MIRT1351323	hsa-miR-3622b-3p	CLIP-seq
MIRT1351324	hsa-miR-3689a-3p	CLIP-seq
MIRT1351325	hsa-miR-3689c	CLIP-seq
MIRT1351326	hsa-miR-3689d	CLIP-seq
MIRT1351327	hsa-miR-371-5p	CLIP-seq
MIRT1351328	hsa-miR-371b-5p	CLIP-seq
MIRT1351329	hsa-miR-3913-5p	CLIP-seq
MIRT1351330	hsa-miR-4284	CLIP-seq
MIRT1351331	hsa-miR-4432	CLIP-seq
MIRT1351332	hsa-miR-4433	CLIP-seq
MIRT1351333	hsa-miR-4459	CLIP-seq
MIRT1351334	hsa-miR-4483	CLIP-seq
MIRT1351335	hsa-miR-4487	CLIP-seq
MIRT1351336	hsa-miR-4534	CLIP-seq
MIRT1351337	hsa-miR-4696	CLIP-seq
MIRT1351338	hsa-miR-4728-5p	CLIP-seq
MIRT1351339	hsa-miR-4761-5p	CLIP-seq
MIRT1351340	hsa-miR-4768-3p	CLIP-seq
MIRT1351341	hsa-miR-4802-5p	CLIP-seq
MIRT1351342	hsa-miR-544b	CLIP-seq
MIRT1351343	hsa-miR-558	CLIP-seq
MIRT1351344	hsa-miR-665	CLIP-seq
MIRT2104108	hsa-miR-1226	CLIP-seq
MIRT1351314	hsa-miR-1293	CLIP-seq
MIRT2104109	hsa-miR-204	CLIP-seq
MIRT2104110	hsa-miR-211	CLIP-seq
MIRT2104111	hsa-miR-3121-5p	CLIP-seq
MIRT1351319	hsa-miR-3165	CLIP-seq
MIRT2104112	hsa-miR-3618	CLIP-seq
MIRT1351322	hsa-miR-3622a-3p	CLIP-seq
MIRT1351323	hsa-miR-3622b-3p	CLIP-seq
MIRT2104113	hsa-miR-3926	CLIP-seq
MIRT1351332	hsa-miR-4433	CLIP-seq
MIRT1351333	hsa-miR-4459	CLIP-seq
MIRT1351334	hsa-miR-4483	CLIP-seq
MIRT2104114	hsa-miR-4755-5p	CLIP-seq
MIRT2104115	hsa-miR-4757-5p	CLIP-seq
MIRT1351339	hsa-miR-4761-5p	CLIP-seq
MIRT1351340	hsa-miR-4768-3p	CLIP-seq
MIRT1351342	hsa-miR-544b	CLIP-seq
MIRT2104116	hsa-miR-548c-3p	CLIP-seq
MIRT2104117	hsa-miR-548s	CLIP-seq
MIRT2104118	hsa-miR-623	CLIP-seq
MIRT2104119	hsa-miR-934	CLIP-seq
MIRT2104108	hsa-miR-1226	CLIP-seq
MIRT1351311	hsa-miR-1228	CLIP-seq
MIRT1351314	hsa-miR-1293	CLIP-seq
MIRT2328225	hsa-miR-25	CLIP-seq
MIRT1351317	hsa-miR-3122	CLIP-seq
MIRT1351318	hsa-miR-3160-3p	CLIP-seq
MIRT1351319	hsa-miR-3165	CLIP-seq
MIRT2328226	hsa-miR-32	CLIP-seq
MIRT2328227	hsa-miR-338-3p	CLIP-seq
MIRT1351320	hsa-miR-342-3p	CLIP-seq
MIRT1351322	hsa-miR-3622a-3p	CLIP-seq
MIRT1351323	hsa-miR-3622b-3p	CLIP-seq
MIRT2328228	hsa-miR-363	CLIP-seq
MIRT2328229	hsa-miR-367	CLIP-seq
MIRT1351324	hsa-miR-3689a-3p	CLIP-seq
MIRT1351325	hsa-miR-3689c	CLIP-seq
MIRT1351329	hsa-miR-3913-5p	CLIP-seq
MIRT2328230	hsa-miR-3929	CLIP-seq
MIRT2328231	hsa-miR-4325	CLIP-seq
MIRT2328232	hsa-miR-4419b	CLIP-seq
MIRT1351332	hsa-miR-4433	CLIP-seq
MIRT1351333	hsa-miR-4459	CLIP-seq
MIRT2328233	hsa-miR-4478	CLIP-seq
MIRT1351334	hsa-miR-4483	CLIP-seq
MIRT1351335	hsa-miR-4487	CLIP-seq
MIRT2328234	hsa-miR-4530	CLIP-seq
MIRT1351338	hsa-miR-4728-5p	CLIP-seq
MIRT1351339	hsa-miR-4761-5p	CLIP-seq
MIRT1351340	hsa-miR-4768-3p	CLIP-seq
MIRT2328235	hsa-miR-508-5p	CLIP-seq
MIRT1351342	hsa-miR-544b	CLIP-seq
MIRT1351343	hsa-miR-558	CLIP-seq
MIRT2328236	hsa-miR-766	CLIP-seq
MIRT2328237	hsa-miR-92a	CLIP-seq
MIRT2328238	hsa-miR-92b	CLIP-seq
MIRT1351314	hsa-miR-1293	CLIP-seq
MIRT1351317	hsa-miR-3122	CLIP-seq
MIRT1351319	hsa-miR-3165	CLIP-seq
MIRT1351322	hsa-miR-3622a-3p	CLIP-seq
MIRT1351323	hsa-miR-3622b-3p	CLIP-seq
MIRT1351324	hsa-miR-3689a-3p	CLIP-seq
MIRT1351325	hsa-miR-3689c	CLIP-seq
MIRT1351329	hsa-miR-3913-5p	CLIP-seq
MIRT1351332	hsa-miR-4433	CLIP-seq
MIRT1351333	hsa-miR-4459	CLIP-seq
MIRT1351334	hsa-miR-4483	CLIP-seq
MIRT1351338	hsa-miR-4728-5p	CLIP-seq
MIRT1351339	hsa-miR-4761-5p	CLIP-seq
MIRT1351340	hsa-miR-4768-3p	CLIP-seq
MIRT1351342	hsa-miR-544b	CLIP-seq
MIRT1351311	hsa-miR-1228	CLIP-seq
MIRT1351313	hsa-miR-1276	CLIP-seq
MIRT1351314	hsa-miR-1293	CLIP-seq
MIRT1351317	hsa-miR-3122	CLIP-seq
MIRT1351319	hsa-miR-3165	CLIP-seq
MIRT1351321	hsa-miR-3613-3p	CLIP-seq
MIRT2104112	hsa-miR-3618	CLIP-seq
MIRT1351322	hsa-miR-3622a-3p	CLIP-seq
MIRT1351323	hsa-miR-3622b-3p	CLIP-seq
MIRT2459442	hsa-miR-3622b-5p	CLIP-seq
MIRT1351324	hsa-miR-3689a-3p	CLIP-seq
MIRT1351325	hsa-miR-3689c	CLIP-seq
MIRT1351327	hsa-miR-371-5p	CLIP-seq
MIRT1351328	hsa-miR-371b-5p	CLIP-seq
MIRT1351329	hsa-miR-3913-5p	CLIP-seq
MIRT1351331	hsa-miR-4432	CLIP-seq
MIRT1351332	hsa-miR-4433	CLIP-seq
MIRT1351333	hsa-miR-4459	CLIP-seq
MIRT1351334	hsa-miR-4483	CLIP-seq
MIRT2459443	hsa-miR-4645-5p	CLIP-seq
MIRT2459444	hsa-miR-4662a-5p	CLIP-seq
MIRT2459445	hsa-miR-4673	CLIP-seq
MIRT2459446	hsa-miR-4676-5p	CLIP-seq
MIRT1351338	hsa-miR-4728-5p	CLIP-seq
MIRT2459447	hsa-miR-4755-3p	CLIP-seq
MIRT1351339	hsa-miR-4761-5p	CLIP-seq
MIRT1351340	hsa-miR-4768-3p	CLIP-seq
MIRT1351342	hsa-miR-544b	CLIP-seq
MIRT2104116	hsa-miR-548c-3p	CLIP-seq
MIRT2459448	hsa-miR-575	CLIP-seq
MIRT2104119	hsa-miR-934	CLIP-seq
MIRT1351311	hsa-miR-1228	CLIP-seq
MIRT1351314	hsa-miR-1293	CLIP-seq
MIRT1351317	hsa-miR-3122	CLIP-seq
MIRT1351319	hsa-miR-3165	CLIP-seq
MIRT2623074	hsa-miR-323-5p	CLIP-seq
MIRT1351321	hsa-miR-3613-3p	CLIP-seq
MIRT2104112	hsa-miR-3618	CLIP-seq
MIRT1351322	hsa-miR-3622a-3p	CLIP-seq
MIRT1351323	hsa-miR-3622b-3p	CLIP-seq
MIRT2459442	hsa-miR-3622b-5p	CLIP-seq
MIRT1351324	hsa-miR-3689a-3p	CLIP-seq
MIRT1351325	hsa-miR-3689c	CLIP-seq
MIRT1351327	hsa-miR-371-5p	CLIP-seq
MIRT1351328	hsa-miR-371b-5p	CLIP-seq
MIRT1351329	hsa-miR-3913-5p	CLIP-seq
MIRT1351331	hsa-miR-4432	CLIP-seq
MIRT1351332	hsa-miR-4433	CLIP-seq
MIRT1351333	hsa-miR-4459	CLIP-seq
MIRT1351334	hsa-miR-4483	CLIP-seq
MIRT2459443	hsa-miR-4645-5p	CLIP-seq
MIRT2459444	hsa-miR-4662a-5p	CLIP-seq
MIRT2459445	hsa-miR-4673	CLIP-seq
MIRT2459446	hsa-miR-4676-5p	CLIP-seq
MIRT1351338	hsa-miR-4728-5p	CLIP-seq
MIRT2459447	hsa-miR-4755-3p	CLIP-seq
MIRT1351339	hsa-miR-4761-5p	CLIP-seq
MIRT1351340	hsa-miR-4768-3p	CLIP-seq
MIRT1351342	hsa-miR-544b	CLIP-seq
MIRT2104116	hsa-miR-548c-3p	CLIP-seq
MIRT2459448	hsa-miR-575	CLIP-seq
MIRT2623075	hsa-miR-876-3p	CLIP-seq
MIRT2104119	hsa-miR-934	CLIP-seq
MIRT1351311	hsa-miR-1228	CLIP-seq
MIRT1351313	hsa-miR-1276	CLIP-seq
MIRT1351314	hsa-miR-1293	CLIP-seq
MIRT1351316	hsa-miR-31	CLIP-seq
MIRT1351317	hsa-miR-3122	CLIP-seq
MIRT1351319	hsa-miR-3165	CLIP-seq
MIRT1351321	hsa-miR-3613-3p	CLIP-seq
MIRT2104112	hsa-miR-3618	CLIP-seq
MIRT1351322	hsa-miR-3622a-3p	CLIP-seq
MIRT1351323	hsa-miR-3622b-3p	CLIP-seq
MIRT1351324	hsa-miR-3689a-3p	CLIP-seq
MIRT1351325	hsa-miR-3689c	CLIP-seq
MIRT1351327	hsa-miR-371-5p	CLIP-seq
MIRT1351328	hsa-miR-371b-5p	CLIP-seq
MIRT1351329	hsa-miR-3913-5p	CLIP-seq
MIRT2104113	hsa-miR-3926	CLIP-seq
MIRT1351331	hsa-miR-4432	CLIP-seq
MIRT1351332	hsa-miR-4433	CLIP-seq
MIRT1351333	hsa-miR-4459	CLIP-seq
MIRT1351334	hsa-miR-4483	CLIP-seq
MIRT2459443	hsa-miR-4645-5p	CLIP-seq
MIRT2459444	hsa-miR-4662a-5p	CLIP-seq
MIRT2459445	hsa-miR-4673	CLIP-seq
MIRT2459446	hsa-miR-4676-5p	CLIP-seq
MIRT1351337	hsa-miR-4696	CLIP-seq
MIRT1351338	hsa-miR-4728-5p	CLIP-seq
MIRT2459447	hsa-miR-4755-3p	CLIP-seq
MIRT1351339	hsa-miR-4761-5p	CLIP-seq
MIRT1351340	hsa-miR-4768-3p	CLIP-seq
MIRT1351342	hsa-miR-544b	CLIP-seq
MIRT2104116	hsa-miR-548c-3p	CLIP-seq
MIRT2104117	hsa-miR-548s	CLIP-seq
MIRT2459448	hsa-miR-575	CLIP-seq
MIRT2104119	hsa-miR-934	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11696592
GO:0005515	Function	Protein binding	IPI	11891219, 16273093, 24728074, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	11696592
GO:0005770	Component	Late endosome	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	11891219
GO:0010008	Component	Endosome membrane	NAS	11696592
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0019724	Process	B cell mediated immunity	TAS	11891219
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035591	Function	Signaling adaptor activity	IBA
GO:0035591	Function	Signaling adaptor activity	IDA	11891219
GO:0042110	Process	T cell activation	IDA	11891219
GO:0042110	Process	T cell activation	IEA
GO:0042110	Process	T cell activation	IEA
GO:0050776	Process	Regulation of immune response	NAS	11696592
GO:0050849	Process	Negative regulation of calcium-mediated signaling	IDA	11696592
GO:0050851	Process	Antigen receptor-mediated signaling pathway	TAS	11696592
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IMP	11891219

MIM	HGNC	e!Ensembl
606577	17329	ENSG00000101082

Q9H6Q3

Protein name

Src-like-adapter 2 (Modulator of antigen receptor signaling) (MARS) (Src-like adapter protein 2) (SLAP-2)

Protein function

Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a C

PDB

4M4Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	38 → 84	SH3 domain	Domain
PF00017	SH2	94 → 176	SH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in immune system, with highest levels in peripheral blood leukocytes. Expressed in spleen, thymus and lymph nodes. Expressed in T-cells as well as in monocytes, and at low level in B-cells. Also detected in plac

Sequence

MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLT
IVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLI
RESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELA
DDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLLFSEAATGEESLLSEG
LRESLSFYISLNDEAVSLDDA

Sequence length

261

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	27717217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant Charcot-Marie-Tooth disease type 2U	Charcot-Marie-Tooth Disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal recessive spastic paraplegia type 70	Spastic Paraplegia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29649015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	27717217, 29655802		★★★★★ ★☆☆☆☆ Found in Text Mining only
CHARCOT-MARIE-TOOTH DISEASE, AXONAL, TYPE 2U	Charcot-Marie-Tooth Disease	BEFREE	29582526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23377640, 29449140, 29649015, 31383853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	28692474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29175219, 29449140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	31821958		★★★★★ ★☆☆☆☆ Found in Text Mining only
INTERSTITIAL LUNG AND LIVER DISEASE	Interstitial Lung And Liver Disease	BEFREE	29655802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	28248208, 28692474, 29266788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28692474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29517585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22647524, 31383853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23377640, 29449140, 29649015, 31383853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	29517585, 29775242		★★★★★ ★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	29606289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe early-onset pulmonary alveolar proteinosis due to MARS deficiency	Pulmonary Alveolar Proteinosis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37688682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	10496256		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLA2 (Src like adaptor 2)