Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	84171
Gene name	Lysyl oxidase like 4
Gene symbol	LOXL4
Synonyms (NCBI Gene)	LOXC
Chromosome	10
Chromosome location	10q24.2
Summary	This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation o

190

Show/Hide all (190)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017606	hsa-miR-335-5p	Microarray	18185580
MIRT022543	hsa-miR-124-3p	Microarray	18668037
MIRT438917	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	23354167
MIRT438917	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCR	23354167
MIRT1115401	hsa-miR-1275	CLIP-seq
MIRT1115402	hsa-miR-3168	CLIP-seq
MIRT1115403	hsa-miR-3199	CLIP-seq
MIRT1115404	hsa-miR-4515	CLIP-seq
MIRT1115405	hsa-miR-4525	CLIP-seq
MIRT1115406	hsa-miR-4640-5p	CLIP-seq
MIRT1115407	hsa-miR-4652-5p	CLIP-seq
MIRT1115408	hsa-miR-4665-5p	CLIP-seq
MIRT1115409	hsa-miR-4723-5p	CLIP-seq
MIRT1115410	hsa-miR-4726-5p	CLIP-seq
MIRT1115411	hsa-miR-4773	CLIP-seq
MIRT1115412	hsa-miR-4797-5p	CLIP-seq
MIRT1115413	hsa-miR-574-5p	CLIP-seq
MIRT1115414	hsa-miR-625	CLIP-seq
MIRT1115415	hsa-miR-759	CLIP-seq
MIRT1550872	hsa-miR-122	CLIP-seq
MIRT1550873	hsa-miR-202	CLIP-seq
MIRT1550874	hsa-miR-2277-3p	CLIP-seq
MIRT1550875	hsa-miR-3126-3p	CLIP-seq
MIRT1550876	hsa-miR-3944-5p	CLIP-seq
MIRT1550877	hsa-miR-4299	CLIP-seq
MIRT1550878	hsa-miR-4456	CLIP-seq
MIRT1550879	hsa-miR-542-3p	CLIP-seq
MIRT1550880	hsa-miR-548q	CLIP-seq
MIRT1115413	hsa-miR-574-5p	CLIP-seq
MIRT1550881	hsa-miR-646	CLIP-seq
MIRT1550882	hsa-miR-648	CLIP-seq
MIRT2032465	hsa-miR-1200	CLIP-seq
MIRT2032466	hsa-miR-3140-5p	CLIP-seq
MIRT2032467	hsa-miR-4324	CLIP-seq
MIRT2032468	hsa-miR-4468	CLIP-seq
MIRT2032469	hsa-miR-516a-3p	CLIP-seq
MIRT2032470	hsa-miR-544b	CLIP-seq
MIRT2032471	hsa-miR-657	CLIP-seq
MIRT2032465	hsa-miR-1200	CLIP-seq
MIRT2262972	hsa-miR-1910	CLIP-seq
MIRT2262973	hsa-miR-2115	CLIP-seq
MIRT2262974	hsa-miR-218	CLIP-seq
MIRT2262975	hsa-miR-223	CLIP-seq
MIRT1550875	hsa-miR-3126-3p	CLIP-seq
MIRT2032466	hsa-miR-3140-5p	CLIP-seq
MIRT2262976	hsa-miR-3179	CLIP-seq
MIRT1115403	hsa-miR-3199	CLIP-seq
MIRT2262977	hsa-miR-320e	CLIP-seq
MIRT2262978	hsa-miR-323b-3p	CLIP-seq
MIRT2262979	hsa-miR-328	CLIP-seq
MIRT2262980	hsa-miR-3622b-5p	CLIP-seq
MIRT2262981	hsa-miR-4253	CLIP-seq
MIRT2262982	hsa-miR-4278	CLIP-seq
MIRT2032467	hsa-miR-4324	CLIP-seq
MIRT2032468	hsa-miR-4468	CLIP-seq
MIRT2262983	hsa-miR-455-3p	CLIP-seq
MIRT2262984	hsa-miR-4677-3p	CLIP-seq
MIRT2262985	hsa-miR-4679	CLIP-seq
MIRT2262986	hsa-miR-4688	CLIP-seq
MIRT2262987	hsa-miR-4697-3p	CLIP-seq
MIRT2262988	hsa-miR-4738-3p	CLIP-seq
MIRT2262989	hsa-miR-4761-3p	CLIP-seq
MIRT2262990	hsa-miR-4793-5p	CLIP-seq
MIRT2262991	hsa-miR-486-3p	CLIP-seq
MIRT2262992	hsa-miR-486-5p	CLIP-seq
MIRT2262993	hsa-miR-513c	CLIP-seq
MIRT2262994	hsa-miR-514b-5p	CLIP-seq
MIRT2032469	hsa-miR-516a-3p	CLIP-seq
MIRT2032470	hsa-miR-544b	CLIP-seq
MIRT2262995	hsa-miR-595	CLIP-seq
MIRT2262996	hsa-miR-636	CLIP-seq
MIRT2032465	hsa-miR-1200	CLIP-seq
MIRT2430811	hsa-miR-1273f	CLIP-seq
MIRT2430812	hsa-miR-143	CLIP-seq
MIRT2430813	hsa-miR-2116	CLIP-seq
MIRT2430814	hsa-miR-3124-3p	CLIP-seq
MIRT2430815	hsa-miR-3616-5p	CLIP-seq
MIRT2430816	hsa-miR-3647-5p	CLIP-seq
MIRT2430817	hsa-miR-3672	CLIP-seq
MIRT2430818	hsa-miR-3684	CLIP-seq
MIRT2430819	hsa-miR-4272	CLIP-seq
MIRT2430820	hsa-miR-4282	CLIP-seq
MIRT2032467	hsa-miR-4324	CLIP-seq
MIRT2430821	hsa-miR-4470	CLIP-seq
MIRT2430822	hsa-miR-4635	CLIP-seq
MIRT2430823	hsa-miR-4670-3p	CLIP-seq
MIRT2430824	hsa-miR-4677-5p	CLIP-seq
MIRT2430825	hsa-miR-4708-5p	CLIP-seq
MIRT2430826	hsa-miR-4770	CLIP-seq
MIRT2032470	hsa-miR-544b	CLIP-seq
MIRT2430827	hsa-miR-573	CLIP-seq
MIRT2430828	hsa-miR-587	CLIP-seq
MIRT1115401	hsa-miR-1275	CLIP-seq
MIRT2562351	hsa-miR-133a	CLIP-seq
MIRT2562352	hsa-miR-133b	CLIP-seq
MIRT2562353	hsa-miR-141	CLIP-seq
MIRT2562354	hsa-miR-200a	CLIP-seq
MIRT2262973	hsa-miR-2115	CLIP-seq
MIRT2562355	hsa-miR-214	CLIP-seq
MIRT2262974	hsa-miR-218	CLIP-seq
MIRT2562356	hsa-miR-29a	CLIP-seq
MIRT2562357	hsa-miR-29b	CLIP-seq
MIRT2562358	hsa-miR-29c	CLIP-seq
MIRT1550875	hsa-miR-3126-3p	CLIP-seq
MIRT2562359	hsa-miR-3127-3p	CLIP-seq
MIRT2562360	hsa-miR-3136-3p	CLIP-seq
MIRT2562361	hsa-miR-3137	CLIP-seq
MIRT2562362	hsa-miR-3176	CLIP-seq
MIRT2562363	hsa-miR-3187-3p	CLIP-seq
MIRT2562364	hsa-miR-3194-3p	CLIP-seq
MIRT1115403	hsa-miR-3199	CLIP-seq
MIRT2262979	hsa-miR-328	CLIP-seq
MIRT2562365	hsa-miR-330-3p	CLIP-seq
MIRT2562366	hsa-miR-337-3p	CLIP-seq
MIRT2562367	hsa-miR-3617	CLIP-seq
MIRT2562368	hsa-miR-3619-5p	CLIP-seq
MIRT2562369	hsa-miR-370	CLIP-seq
MIRT2562370	hsa-miR-3909	CLIP-seq
MIRT2562371	hsa-miR-3922-3p	CLIP-seq
MIRT2562372	hsa-miR-3936	CLIP-seq
MIRT2562373	hsa-miR-4269	CLIP-seq
MIRT2562374	hsa-miR-4274	CLIP-seq
MIRT2562375	hsa-miR-4291	CLIP-seq
MIRT2562376	hsa-miR-4476	CLIP-seq
MIRT2562377	hsa-miR-4492	CLIP-seq
MIRT2562378	hsa-miR-4493	CLIP-seq
MIRT2562379	hsa-miR-4498	CLIP-seq
MIRT2562380	hsa-miR-4505	CLIP-seq
MIRT2562381	hsa-miR-450b-5p	CLIP-seq
MIRT2562382	hsa-miR-4514	CLIP-seq
MIRT1115404	hsa-miR-4515	CLIP-seq
MIRT1115405	hsa-miR-4525	CLIP-seq
MIRT2562383	hsa-miR-4529-5p	CLIP-seq
MIRT1115406	hsa-miR-4640-5p	CLIP-seq
MIRT2562384	hsa-miR-4652-3p	CLIP-seq
MIRT1115407	hsa-miR-4652-5p	CLIP-seq
MIRT1115408	hsa-miR-4665-5p	CLIP-seq
MIRT2262984	hsa-miR-4677-3p	CLIP-seq
MIRT2262985	hsa-miR-4679	CLIP-seq
MIRT2562385	hsa-miR-4691-5p	CLIP-seq
MIRT2562386	hsa-miR-4692	CLIP-seq
MIRT2562387	hsa-miR-4694-5p	CLIP-seq
MIRT1115409	hsa-miR-4723-5p	CLIP-seq
MIRT1115410	hsa-miR-4726-5p	CLIP-seq
MIRT2562388	hsa-miR-4731-5p	CLIP-seq
MIRT2262988	hsa-miR-4738-3p	CLIP-seq
MIRT2562389	hsa-miR-4742-5p	CLIP-seq
MIRT2562390	hsa-miR-4749-3p	CLIP-seq
MIRT2562391	hsa-miR-4777-3p	CLIP-seq
MIRT2262993	hsa-miR-513c	CLIP-seq
MIRT2262994	hsa-miR-514b-5p	CLIP-seq
MIRT2032469	hsa-miR-516a-3p	CLIP-seq
MIRT2562392	hsa-miR-518a-5p	CLIP-seq
MIRT2562393	hsa-miR-527	CLIP-seq
MIRT2562394	hsa-miR-544	CLIP-seq
MIRT2562395	hsa-miR-615-5p	CLIP-seq
MIRT1115414	hsa-miR-625	CLIP-seq
MIRT2262996	hsa-miR-636	CLIP-seq
MIRT2562396	hsa-miR-641	CLIP-seq
MIRT2562397	hsa-miR-676	CLIP-seq
MIRT2562398	hsa-miR-761	CLIP-seq
MIRT2562399	hsa-miR-762	CLIP-seq
MIRT2562400	hsa-miR-922	CLIP-seq
MIRT2562355	hsa-miR-214	CLIP-seq
MIRT2562359	hsa-miR-3127-3p	CLIP-seq
MIRT2562360	hsa-miR-3136-3p	CLIP-seq
MIRT2262979	hsa-miR-328	CLIP-seq
MIRT2562368	hsa-miR-3619-5p	CLIP-seq
MIRT2562372	hsa-miR-3936	CLIP-seq
MIRT2562373	hsa-miR-4269	CLIP-seq
MIRT2562374	hsa-miR-4274	CLIP-seq
MIRT2562375	hsa-miR-4291	CLIP-seq
MIRT2562377	hsa-miR-4492	CLIP-seq
MIRT2562379	hsa-miR-4498	CLIP-seq
MIRT2562380	hsa-miR-4505	CLIP-seq
MIRT2562382	hsa-miR-4514	CLIP-seq
MIRT2562386	hsa-miR-4692	CLIP-seq
MIRT2562387	hsa-miR-4694-5p	CLIP-seq
MIRT2562388	hsa-miR-4731-5p	CLIP-seq
MIRT2262988	hsa-miR-4738-3p	CLIP-seq
MIRT2562389	hsa-miR-4742-5p	CLIP-seq
MIRT2562390	hsa-miR-4749-3p	CLIP-seq
MIRT2562391	hsa-miR-4777-3p	CLIP-seq
MIRT2262993	hsa-miR-513c	CLIP-seq
MIRT2262994	hsa-miR-514b-5p	CLIP-seq
MIRT2562394	hsa-miR-544	CLIP-seq
MIRT2562395	hsa-miR-615-5p	CLIP-seq
MIRT2562398	hsa-miR-761	CLIP-seq
MIRT2562399	hsa-miR-762	CLIP-seq
MIRT2562400	hsa-miR-922	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SP1	Activation	18949373

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004720	Function	Protein-lysine 6-oxidase activity	IBA
GO:0004720	Function	Protein-lysine 6-oxidase activity	IDA	14551188
GO:0004720	Function	Protein-lysine 6-oxidase activity	IEA
GO:0005507	Function	Copper ion binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 23455924, 25416956, 28514442, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016641	Function	Oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor	IEA
GO:0030199	Process	Collagen fibril organization	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708

MIM	HGNC	e!Ensembl
607318	17171	ENSG00000138131

Q96JB6

Protein name

Lysyl oxidase homolog 4 (EC 1.4.3.13) (Lysyl oxidase-like protein 4) (Lysyl oxidase-related protein C)

Protein function

Catalyzes the oxidative deamination of lysine and hydroxylysine residues in collagen and elastin, resulting in the formation of covalent cross-linkages, and the stabilization of collagen and elastin fibers.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00530	SRCR	37 → 133	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	169 → 287	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	314 → 411	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	424 → 529	Scavenger receptor cysteine-rich domain	Domain
PF01186	Lysyl_oxidase	533 → 733	Lysyl oxidase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tissues, the highest levels among the tissues studied being in the skeletal muscle, testis and pancreas. Expressed in cartilage.

Sequence

MAWSPPATLFLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDD
NFAIQEATVACRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCGSNGWGVS
DCSHSEDVGVICHPRRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVE
VKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVDSHYYRKVWDLKMRDPKSRLKSLTN
KNSFWIHQVTCLGTEPHMANCQVQVAPARGKLRPACPGGMHAVVSCVAGPHFRPPKTKPQ
RKGSWAEEPRVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWNLISASVVCRQLGFGSAREA
LFGARLGQGLGPIHLSEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQ
VRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAYKETWF
WSGTPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQ
LVQETAYLEDRPLSQLYCAHEENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKT
GRDSWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACAN
FGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVIVNPHYEVAESDFSNNMLQCRCK
YDGHRVWLHNCHTGNSYPANAELSLEQEQRLRNNLI

Sequence length

756

Interactions

View interactions

	Reactome
			Elastic fibre formation Crosslinking of collagen fibrils

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DYSPLASIA OF THE HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SYSTEM ATROPHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKELETAL DYSPLASIA	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (47)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17456585, 25311867, 29732010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	17456585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22806361, 22921864, 28060764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38518152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17354256, 21115907, 22806361, 24792014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26097573	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30704479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17456585, 25311867, 29732010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30633357, 30993701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19724858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36949528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21733505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21733505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	40234833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32725165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	34565340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	33757755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33757755	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30457362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	21733505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	17287949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	33757755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26138381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26097573, 30704479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30704479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22921864, 28060764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30728460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30633357, 30993701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25216702, 30045039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17456585, 25311867, 29732010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	17456585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21115907, 22806361, 25216702, 26097573, 30045039, 30704479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28060764		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30098867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17354256, 18949373, 19724858, 22806361, 25216702, 26097573, 26138381, 26756583, 28060764, 30704479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	24357854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	29532123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	33413618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17671119, 18949373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21115907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30900087, 31217847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35113007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17354256, 18949373, 26756583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25216702, 30045039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36044785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	31705627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28060764		★★★★★ ★☆☆☆☆ Found in Text Mining only

LOXL4 (lysyl oxidase like 4)