ANXA9 (annexin A9)

Gene

• Entrez ID: 8416
• Gene name: Annexin A9
• Gene symbol: ANXA9
• Synonyms (NCBI Gene): ANX31
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The annexins are a family of calcium-dependent phospholipid-binding proteins. Members of the annexin family contain 4 internal repeat domains, each of which includes a type II calcium-binding site. The calcium-binding sites are required for annexins to ag

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT756264	hsa-miR-186-5p	Luciferase reporter assay, Western blotting, qRT-PCR	37841425
MIRT786705	hsa-miR-216a	CLIP-seq
MIRT786706	hsa-miR-3157-5p	CLIP-seq
MIRT786707	hsa-miR-4330	CLIP-seq
MIRT786708	hsa-miR-4691-3p	CLIP-seq
MIRT2172458	hsa-miR-1207-3p	CLIP-seq
MIRT2172459	hsa-miR-3612	CLIP-seq
MIRT2172460	hsa-miR-432	CLIP-seq
MIRT2172461	hsa-miR-4443	CLIP-seq
MIRT2172462	hsa-miR-650	CLIP-seq
MIRT2172463	hsa-miR-890	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0001786	Function	Phosphatidylserine binding	IDA	12832069
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	22841549, 33961781
GO:0005543	Function	Phospholipid binding	IDA	10899159
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005544	Function	Calcium-dependent phospholipid binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IDA	12832069
GO:0005886	Component	Plasma membrane	IBA
GO:0007155	Process	Cell adhesion	IBA
GO:0007271	Process	Synaptic transmission, cholinergic	IEA
GO:0009986	Component	Cell surface	IDA	10899159
GO:0012506	Component	Vesicle membrane	IBA
GO:0015464	Function	Acetylcholine receptor activity	IDA	10899159
GO:0016328	Component	Lateral plasma membrane	ISS
GO:0045202	Component	Synapse	IEA
GO:0098609	Process	Cell-cell adhesion	IDA	10899159

Other IDs

• MIM: 603319
• HGNC: 547
• e!Ensembl: ENSG00000143412

Protein

• UniProt ID: O76027
• Protein name: Annexin A9 (Annexin XXXI) (Annexin-31) (Annexin-9) (Pemphaxin)
• Protein function: Low affinity receptor for acetylcholine known to be targeted by disease-causing pemphigus vulgaris antibodies in keratinocytes.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00191	Annexin	45 → 110	Annexin	Family
  PF00191	Annexin	117 → 182	Annexin	Family
  PF00191	Annexin	201 → 264	Annexin	Family
  PF00191	Annexin	274 → 339	Annexin	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the stratified squamous skin epithelium, but not in epithelia of other types (at protein level). {ECO:0000269|PubMed:10899159}.
• Sequence:

  MSVTGGKMAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVD
  RSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQ
  ELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLL
  ALAKGGRDSYSGIIDYNLAEQDVQALQRAEGPSREETWVPVFTQRNPEHLIRVFDQYQRS
  TGQELEEAVQNRFHGDAQVALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISR
  CETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM

• Sequence length: 345

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONSILLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37464398	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29393380		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37349657	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29393380		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21926416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	21926416	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	30744186		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31474227, 33680718	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30744186		★☆☆☆☆ Found in Text Mining only