PPP1R1B (protein phosphatase 1 regulatory inhibitor subunit 1B)

Gene

• Entrez ID: 84152
• Gene name: Protein phosphatase 1 regulatory inhibitor subunit 1B
• Gene symbol: PPP1R1B
• Synonyms (NCBI Gene): DARPP-32, DARPP32
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT733522	hsa-miR-7844-5p	Luciferase reporter assay, RNA-seq, qRT-PCR	33189894
MIRT1256355	hsa-miR-1275	CLIP-seq
MIRT1256356	hsa-miR-4525	CLIP-seq
MIRT1256357	hsa-miR-4665-5p	CLIP-seq
MIRT1256358	hsa-miR-4723-5p	CLIP-seq
MIRT1256359	hsa-miR-490-3p	CLIP-seq
MIRT1256360	hsa-miR-566	CLIP-seq
MIRT1256361	hsa-miR-625	CLIP-seq
MIRT1256362	hsa-miR-637	CLIP-seq
MIRT1256363	hsa-miR-1343	CLIP-seq
MIRT1256364	hsa-miR-330-3p	CLIP-seq
MIRT1256365	hsa-miR-4642	CLIP-seq
MIRT1256366	hsa-miR-4720-5p	CLIP-seq
MIRT1256367	hsa-miR-4799-3p	CLIP-seq
MIRT2302161	hsa-miR-1182	CLIP-seq
MIRT2302162	hsa-miR-146b-3p	CLIP-seq
MIRT2302163	hsa-miR-193a-5p	CLIP-seq
MIRT2302164	hsa-miR-3173-5p	CLIP-seq
MIRT2302165	hsa-miR-3945	CLIP-seq
MIRT2302166	hsa-miR-4253	CLIP-seq
MIRT2302167	hsa-miR-4269	CLIP-seq
MIRT2302168	hsa-miR-4514	CLIP-seq
MIRT2302169	hsa-miR-4692	CLIP-seq
MIRT2302170	hsa-miR-4711-5p	CLIP-seq
MIRT2302171	hsa-miR-4722-3p	CLIP-seq
MIRT2302172	hsa-miR-4742-5p	CLIP-seq
MIRT2302173	hsa-miR-541	CLIP-seq
MIRT2302174	hsa-miR-654-5p	CLIP-seq
MIRT2302175	hsa-miR-874	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0004860	Function	Protein kinase inhibitor activity	TAS	10604473
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	TAS
GO:0004864	Function	Protein phosphatase inhibitor activity	IDA	10807923
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0004864	Function	Protein phosphatase inhibitor activity	TAS	10604473
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10604473
GO:0007621	Process	Negative regulation of female receptivity	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008542	Process	Visual learning	IEA
GO:0019888	Function	Protein phosphatase regulator activity	TAS
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043278	Process	Response to morphine	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0071314	Process	Cellular response to cocaine	IEA

Other IDs

• MIM: 604399
• HGNC: 9287
• e!Ensembl: ENSG00000131771

Protein

• UniProt ID: Q9UD71
• Protein name: Protein phosphatase 1 regulatory subunit 1B (DARPP-32) (Dopamine- and cAMP-regulated neuronal phosphoprotein)
• Protein function: Inhibitor of protein-phosphatase 1.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05395	DARPP-32	2 → 181	Protein phosphatase inhibitor 1/DARPP-32	Family

• Sequence:

  MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGE
  GHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREE
  DEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSED
  QVEDPALSEPGEEPQRPSPSEPGT

• Sequence length: 204

Pathways

KEGG:

cAMP signaling pathway
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism

Reactome:

DARPP-32 events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINESIAS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal involuntary movement	Abnormal Involuntary Movement	BEFREE	28424060		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	14508844, 26872373		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	14508844		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	31896117	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	17948899		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	22559203	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	22559203		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	22559203		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	22559203	Associate	★☆☆☆☆ Found in Text Mining only
Ballismus	Ballismus	CTD_human_DG	20682746		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	LHGDN	17521792, 18055181		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	18055181, 18573638, 23295814, 31619735		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18055181, 18573638, 20874815, 23295814		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	15010812, 19301121, 19593441, 20836878, 25128420, 30552871, 31740718		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19593441	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20836878, 29180608, 31740718, 33991172, 34224831, 37626402, 38036593	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14508844, 15188007, 25779598	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22589394	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14508844, 16061638		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17695523	Inhibit	★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	CTD_human_DG	20682746		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	24232252		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30997746		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25692420	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	27591185		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	19834457		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	31060804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28396702		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	CTD_human_DG	20682746		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	22753408		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15188007	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	17470401		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23250732		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23250732	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23250732		★☆☆☆☆ Found in Text Mining only
Hemiballismus	Hemiballismus	CTD_human_DG	20682746		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	14999077, 22748967, 22876937, 23669348, 24285878, 24827816, 28359739, 28973411, 29209158, 29462355, 31060804, 31447328, 31822756		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25275533, 31447328, 40336225	Associate	★☆☆☆☆ Found in Text Mining only
Lingual-Facial-Buccal Dyskinesia	Orofacial dyskinesia	CTD_human_DG	20682746		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	18385100		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15010812, 19301121, 19593441, 20836878, 25128420, 26872373, 30552871, 31740718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12124342, 15010812, 17470401, 17492506, 22589394, 23160836, 24276243, 30552871		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15188007, 25128420, 26872373		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17027969, 18579663		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19301121, 20836878, 25128420		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	19834457		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	31060804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	23295814		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	17695523	Inhibit	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	22615781		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14508844, 15188007, 16061638, 16850143, 20580047, 23250732, 24276243, 25128420, 25779598, 26119931		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28052701		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	26561806		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31896117	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	23250732	Stimulate	★☆☆☆☆ Found in Text Mining only
Oral Dyskinesia	Oral Dyskinesia	CTD_human_DG	20682746		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32588513	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28052701, 29778803		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	22615781, 22753408		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	26561806		★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	31235784		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16750903, 17290303, 17618027, 18055181, 18573638, 19463699, 20483474, 20874815, 21453742, 22179181, 22576830, 23295814, 24704945, 26872373, 28881851, 29627696, 31619735		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17290303, 17521792, 18055181		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20874815, 21453742, 22179181, 23295814, 24704945		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	26081799		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15188007		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15188007, 16850143		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17695523	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15010812, 17470401, 17492506, 22589394, 24276243		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14508844, 22589394, 25779598	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14991576, 17492506, 18058465		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15188007	Stimulate	★☆☆☆☆ Found in Text Mining only