Gene Gene information from NCBI Gene database.
Entrez ID 84140
Gene name FAM161 centrosomal protein A
Gene symbol FAM161A
Synonyms (NCBI Gene)
RP28
Chromosome 2
Chromosome location 2p15
Summary This gene belongs to the FAM161 family. It is expressed mainly in the retina. Mouse studies suggested that this gene is involved in development of retinal progenitors during embryogenesis, and that its activity is restricted to mature photoreceptors after
SNPs SNP information provided by dbSNP.
22
SNP ID Visualize variation Clinical significance Consequence
rs4672457 A>G,T Likely-pathogenic, benign Synonymous variant, coding sequence variant, non coding transcript variant, stop gained
rs138464813 A>G Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Genic downstream transcript variant, coding sequence variant, synonymous variant, non coding transcript variant, intron variant
rs139266382 G>C Conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, missense variant
rs140622968 C>A Conflicting-interpretations-of-pathogenicity, uncertain-significance Non coding transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs187695569 A>C Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
187
miRTarBase ID miRNA Experiments Reference
MIRT981438 hsa-miR-1206 CLIP-seq
MIRT981439 hsa-miR-122 CLIP-seq
MIRT981440 hsa-miR-1234 CLIP-seq
MIRT981441 hsa-miR-1307 CLIP-seq
MIRT981442 hsa-miR-1343 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000235 Component Astral microtubule IDA 22791751
GO:0001917 Component Photoreceptor inner segment IDA 22791751
GO:0005515 Function Protein binding IPI 22791751, 22940612, 25018096, 25416956, 26638075, 27107012, 29892012, 31515488, 32296183, 32814053, 33961781, 36233334
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613596 25808 ENSG00000170264
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q3B820
Protein name Protein FAM161A
Protein function Involved in ciliogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10595 UPF0564 234 592 Uncharacterised protein family UPF0564 Family
Tissue specificity TISSUE SPECIFICITY: Isoform 1 and isoform 3 are widely expressed with highest levels in retina and testis, with isoform 1 being the most abundant in all tissues tested. {ECO:0000269|PubMed:20705278, ECO:0000269|PubMed:20705279, ECO:0000269|PubMed:36233334
Sequence
MATSHRVAKLVASSLQTPVNPITGARVAQYEREDPLKALAAAEAILEDEEEEKVAQPAGA
SADLNTSFSGVDEHAPISYEDFVNFPDIHHSNEEYFKKVEELKAAHIETMAKLEKMYQDK
LHLKEVQPVVIREDSLSDSSRSVSEKNSYHPVSLMTSFSEPDLGQSSSLYVSSSEEELPN
LEKEYPRKNRMMTYAKELINNMWTDFCVEDYIRCKDTGFHAAEKRRKKRKEWVPTITVPE
PFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEYKKKFRANPVPASVFLPLYHDLV
KQKEERRRSLKEKSKEALLASQKPFKFIAREEQKRAAREKQLRDFLKYKKKTNRFKARPI
PRSTYGSTTNDKLKEEELYRNLRTQLRAQEHLQNSSPLPCRSACGCRNPRCPEQAVKLKC
KHKVRCPTPDFEDLPERYQKHLSEHKSPKLLTVCKPFDLHASPHASIKREKILADIEADE
ENLKETRWPYLSPRRKSPVRCAGVNPVPCNCNPPVPTVSSRGREQAVRKSEKERMREYQR
ELEEREEKLKKRPLLFERVAQKNARMAAEKHYSNTLKALGISDEFVSKKGQS
GKVLEYFN
NQETKSVTEDKESFNEEEKIEERENGEENYFIDTNSQDSYKEKDEANEESEEEKSVEESH
Sequence length 660
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
11
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autosomal recessive retinitis pigmentosa Pathogenic rs267606794, rs1553354861, rs777678022 RCV001257835
RCV001257778
RCV001257889
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cone-rod dystrophy Pathogenic rs200691042 RCV000678572
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FAM161A-related disorder Likely pathogenic; Pathogenic rs767414973 RCV004758047
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Retinal dystrophy Pathogenic; Likely pathogenic rs267606794, rs200691042, rs397704718, rs202193201, rs758751113, rs761440783, rs777579457, rs771687855, rs1672921868, rs767414973, rs1167380267 RCV001074032
RCV000787604
RCV001073488
RCV000787606
RCV004818228
View all (6 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONE-ROD DYSTROPHIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1 CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Retinitis Pigmentosa, Recessive Likely benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cataract Cataract HPO_DG
★☆☆☆☆
Found in Text Mining only
Ciliopathies Ciliopathies BEFREE 22940612
★☆☆☆☆
Found in Text Mining only
Conductive hearing loss Hearing Loss HPO_DG
★☆☆☆☆
Found in Text Mining only
Cone-Rod Dystrophies Cone-rod dystrophy CLINVAR_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Congenital hypoplasia of penis Congenital Hypoplasia Of Penis HPO_DG
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus HPO_DG
★☆☆☆☆
Found in Text Mining only
Disorder of eye Disorder Of Eye GENOMICS_ENGLAND_DG
★☆☆☆☆
Found in Text Mining only
Glaucoma Glaucoma HPO_DG
★☆☆☆☆
Found in Text Mining only
Hyperinsulinism Hyperinsulinism HPO_DG
★☆☆☆☆
Found in Text Mining only
Hypogonadism Hypogonadism HPO_DG
★☆☆☆☆
Found in Text Mining only