Gene Gene information from NCBI Gene database.
Entrez ID 84138
Gene name Solute carrier family 7 member 6 opposite strand
Gene symbol SLC7A6OS
Synonyms (NCBI Gene)
EPM12Iwr1
Chromosome 16
Chromosome location 16q22.1
miRNA miRNA information provided by mirtarbase database.
159
miRTarBase ID miRNA Experiments Reference
MIRT664723 hsa-miR-6887-3p HITS-CLIP 23824327
MIRT664722 hsa-miR-4780 HITS-CLIP 23824327
MIRT664721 hsa-miR-6780b-3p HITS-CLIP 23824327
MIRT664720 hsa-miR-4287 HITS-CLIP 23824327
MIRT664719 hsa-miR-4685-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0002244 Process Hematopoietic progenitor cell differentiation IEA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0015031 Process Protein transport IEA
GO:0032502 Process Developmental process IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619192 25807 ENSG00000103061
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96CW6
Protein name Probable RNA polymerase II nuclear localization protein SLC7A6OS (ADAMS proteinase-related protein) (Solute carrier family 7 member 6 opposite strand transcript)
Protein function Directs RNA polymerase II nuclear import.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08574 Iwr1 194 257 Transcription factor Iwr1 Family
Sequence
MEAARTAVLRVKRKRSAEPAEALVLACKRLRSDAVESAAQKTSEGLERAAENNVFHLVAT
VCSQEEPVQPLLREVLRPSRDSQQRVRRNLRASAREVRQEGRYRVLSSRRSLGTTSSGQE
SEYTPGNPEAAGNSGFQLLDLVHEEGEPEAASAGSCKTSDPDVILCNSVELIRERLTVSE
DGPGVRRQEEQKHDDYVYDIYYLETATPGWIENILSVQPYSQEWELVNDDQEPEDIYDDE
DDENSENNWRNEYPEEE
SSDGDEDSRGSADYNSLSEEERGSSRQRMWSKYPLDVQKEFGY
DSPHDLDSD
Sequence length 309
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Clear cell carcinoma of kidney Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EPILEPSY Disgenet, GenCC
Disgenet, GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Epilepsy, progressive myoclonic, 12 Uncertain significance ClinVar
ClinVar, Disgenet, GWAS catalog, HPO
ClinVar, Disgenet, GWAS catalog, HPO
ClinVar, Disgenet, GWAS catalog, HPO
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Familial cancer of breast Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Schizophrenia Schizophrenia GWASCAT_DG 28991256, 30285260
★★☆☆☆
Found in Text Mining + Unknown/Other Associations