BCAR3 (BCAR3 adaptor protein, NSP family member)

Gene

• Entrez ID: 8412
• Gene name: BCAR3 adaptor protein, NSP family member
• Gene symbol: BCAR3
• Synonyms (NCBI Gene): AND-34, MIG7, NSP2, SH2D3B
• Chromosome: 1
• Chromosome location: 1p22.1
• Summary: Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was i

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT042690	hsa-miR-196b-5p	CLASH	23622248
MIRT817512	hsa-miR-1237	CLIP-seq
MIRT817513	hsa-miR-1914	CLIP-seq
MIRT817514	hsa-miR-19a	CLIP-seq
MIRT817515	hsa-miR-19b	CLIP-seq
MIRT817516	hsa-miR-203	CLIP-seq
MIRT817517	hsa-miR-3140-3p	CLIP-seq
MIRT817518	hsa-miR-3194-3p	CLIP-seq
MIRT817519	hsa-miR-3200-5p	CLIP-seq
MIRT817520	hsa-miR-3660	CLIP-seq
MIRT817521	hsa-miR-3662	CLIP-seq
MIRT817522	hsa-miR-3671	CLIP-seq
MIRT817523	hsa-miR-3691-5p	CLIP-seq
MIRT817524	hsa-miR-4526	CLIP-seq
MIRT817525	hsa-miR-4699-3p	CLIP-seq
MIRT817526	hsa-miR-4724-3p	CLIP-seq
MIRT817527	hsa-miR-4752	CLIP-seq
MIRT817528	hsa-miR-4766-5p	CLIP-seq
MIRT817529	hsa-miR-4802-3p	CLIP-seq
MIRT817530	hsa-miR-522	CLIP-seq
MIRT817531	hsa-miR-548a-3p	CLIP-seq
MIRT817532	hsa-miR-548e	CLIP-seq
MIRT817533	hsa-miR-548f	CLIP-seq
MIRT817534	hsa-miR-568	CLIP-seq
MIRT817535	hsa-miR-643	CLIP-seq
MIRT817536	hsa-miR-889	CLIP-seq
MIRT1545707	hsa-miR-199a-3p	CLIP-seq
MIRT1545708	hsa-miR-199b-3p	CLIP-seq
MIRT1545709	hsa-miR-3129-5p	CLIP-seq
MIRT1545710	hsa-miR-4668-3p	CLIP-seq
MIRT1545711	hsa-miR-4760-3p	CLIP-seq
MIRT1545712	hsa-miR-802	CLIP-seq
MIRT1545713	hsa-miR-936	CLIP-seq
MIRT1545707	hsa-miR-199a-3p	CLIP-seq
MIRT1545708	hsa-miR-199b-3p	CLIP-seq
MIRT1545709	hsa-miR-3129-5p	CLIP-seq
MIRT1941722	hsa-miR-628-5p	CLIP-seq
MIRT817514	hsa-miR-19a	CLIP-seq
MIRT817515	hsa-miR-19b	CLIP-seq
MIRT817518	hsa-miR-3194-3p	CLIP-seq
MIRT2180553	hsa-miR-595	CLIP-seq
MIRT2180554	hsa-miR-648	CLIP-seq
MIRT817512	hsa-miR-1237	CLIP-seq
MIRT2483907	hsa-miR-1244	CLIP-seq
MIRT1545707	hsa-miR-199a-3p	CLIP-seq
MIRT1545708	hsa-miR-199b-3p	CLIP-seq
MIRT817516	hsa-miR-203	CLIP-seq
MIRT1545709	hsa-miR-3129-5p	CLIP-seq
MIRT817517	hsa-miR-3140-3p	CLIP-seq
MIRT817519	hsa-miR-3200-5p	CLIP-seq
MIRT817520	hsa-miR-3660	CLIP-seq
MIRT817521	hsa-miR-3662	CLIP-seq
MIRT817522	hsa-miR-3671	CLIP-seq
MIRT2483908	hsa-miR-4274	CLIP-seq
MIRT2483909	hsa-miR-4519	CLIP-seq
MIRT2483910	hsa-miR-4524	CLIP-seq
MIRT817524	hsa-miR-4526	CLIP-seq
MIRT817525	hsa-miR-4699-3p	CLIP-seq
MIRT817526	hsa-miR-4724-3p	CLIP-seq
MIRT2483911	hsa-miR-4753-3p	CLIP-seq
MIRT817528	hsa-miR-4766-5p	CLIP-seq
MIRT817529	hsa-miR-4802-3p	CLIP-seq
MIRT2483912	hsa-miR-513a-3p	CLIP-seq
MIRT817530	hsa-miR-522	CLIP-seq
MIRT817531	hsa-miR-548a-3p	CLIP-seq
MIRT817532	hsa-miR-548e	CLIP-seq
MIRT817533	hsa-miR-548f	CLIP-seq
MIRT1941722	hsa-miR-628-5p	CLIP-seq
MIRT2483913	hsa-miR-942	CLIP-seq
MIRT817521	hsa-miR-3662	CLIP-seq
MIRT817522	hsa-miR-3671	CLIP-seq
MIRT2483911	hsa-miR-4753-3p	CLIP-seq
MIRT817529	hsa-miR-4802-3p	CLIP-seq
MIRT2483912	hsa-miR-513a-3p	CLIP-seq
MIRT817530	hsa-miR-522	CLIP-seq
MIRT817531	hsa-miR-548a-3p	CLIP-seq
MIRT817532	hsa-miR-548e	CLIP-seq
MIRT817533	hsa-miR-548f	CLIP-seq
MIRT1941722	hsa-miR-628-5p	CLIP-seq
MIRT2483913	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IMP	24216110
GO:0002089	Process	Lens morphogenesis in camera-type eye	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16273093, 18722344, 19086031, 22081014, 24728074, 25416956, 25640309, 25814554, 28514442, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005925	Component	Focal adhesion	IEA
GO:0005925	Component	Focal adhesion	ISS
GO:0007165	Process	Signal transduction	TAS	9582273
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	18722344
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18722344
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IMP	24216110
GO:0009410	Process	Response to xenobiotic stimulus	TAS	9582273
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0019900	Function	Kinase binding	IPI	18722344
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	24216110
GO:0043547	Process	Positive regulation of GTPase activity	IMP	19086031
GO:0070161	Component	Anchoring junction	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IBA
GO:0086100	Process	Endothelin receptor signaling pathway	IMP	19086031

Other IDs

• MIM: 604704
• HGNC: 973
• e!Ensembl: ENSG00000137936

Protein

• UniProt ID: O75815
• Protein name: Breast cancer anti-estrogen resistance protein 3 (Novel SH2-containing protein 2) (SH2 domain-containing protein 3B)
• Protein function: Acts as an adapter protein downstream of several growth factor receptors to promote cell proliferation, migration, and redistribution of actin fibers (PubMed:24216110). Specifically involved in INS/insulin signaling pathway by mediating MAPK1/ER
• PDB: 3T6A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	154 → 234	SH2 domain	Domain
  PF00617	RasGEF	545 → 737	RasGEF domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. Found in several cancer cell lines, but not in nonmalignant breast tissue. {ECO:0000269|PubMed:10187783, ECO:0000269|PubMed:9582273}.
• Sequence:

  MAAGKFASLPRNMPVNHQFPLASSMDLLSSRSPLAEHRPDAYQDVSIHGTLPRKKKGPPP
  IRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTFRDPHLLDPTVEYVKF
  SKERHIMDRTPEKLKKELEEELLLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSL
  SSPGNFVLTCQWKNLAQHFKINRTVLRLSEAYSRVQYQFEMESFDSIPGLVRCYVGNRRP
  ISQQSGAIIFQPINRTVPLRCLEEHYGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQARE
  QNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPC
  PNSPVFRTGSEPALSPAVVRRVSSDARAGEALRGSDSQLCPKPPPKPCKVPFLKVPSSPS
  AWLNSEANYCELNPAFATGCGRGAKLPSCAQGSHTELLTAKQNEAPGPRNSGVNYLILDD
  DDRERPWEPAAAQMEKGQWDKGEFVTPLLETVSSFRPNEFESKFLPPENKPLETAMLKRA
  KELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIE
  RHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQIT
  RLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQ
  AVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKT
  EFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL

• Sequence length: 825

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	14583477, 15642172, 17427198, 17616674, 19454314, 19940159, 23762409, 24169358, 24584939, 25499443, 27109104, 30563570		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15642172, 17427198, 19454314, 23762409, 24169358, 24584939, 31233772	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35842733	Associate	★☆☆☆☆ Found in Text Mining only
Cyclocephaly	Cyclocephaly	BEFREE	28028038		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	31233772	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31233772		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31233772	Associate	★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	17427198, 31233772		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	22487061, 30322331		★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	17427198	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	31233772	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	27777418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	14583477, 15642172, 17427198, 17616674, 19454314, 19940159, 23762409, 24169358, 24584939, 25499443, 27109104, 30563570		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24584939		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17270363, 17427198, 17616674		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25499443, 27109104		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19075277		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31737638		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30563570		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	30563570	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31737638		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15899130		★☆☆☆☆ Found in Text Mining only