Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	84107
Gene name	Zic family zinc finger 4
Gene symbol	ZIC4
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3q24
Summary	This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked t

111

Show/Hide all (111)

miRTarBase ID	miRNA	Experiments	Reference
MIRT627179	hsa-miR-892a	HITS-CLIP	23824327
MIRT627178	hsa-miR-6760-3p	HITS-CLIP	23824327
MIRT640634	hsa-miR-1208	HITS-CLIP	23824327
MIRT627177	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT627176	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT627175	hsa-miR-4420	HITS-CLIP	23824327
MIRT627174	hsa-miR-653-3p	HITS-CLIP	23824327
MIRT627173	hsa-miR-5096	HITS-CLIP	23824327
MIRT627172	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT627179	hsa-miR-892a	HITS-CLIP	23824327
MIRT627178	hsa-miR-6760-3p	HITS-CLIP	23824327
MIRT627177	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT627176	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT627175	hsa-miR-4420	HITS-CLIP	23824327
MIRT627174	hsa-miR-653-3p	HITS-CLIP	23824327
MIRT627173	hsa-miR-5096	HITS-CLIP	23824327
MIRT627172	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT441707	hsa-miR-105-5p	PAR-CLIP	22100165
MIRT441704	hsa-miR-7853-5p	PAR-CLIP	22100165
MIRT441705	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT627179	hsa-miR-892a	HITS-CLIP	23824327
MIRT627178	hsa-miR-6760-3p	HITS-CLIP	23824327
MIRT640634	hsa-miR-1208	HITS-CLIP	23824327
MIRT627177	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT627176	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT627175	hsa-miR-4420	HITS-CLIP	23824327
MIRT627174	hsa-miR-653-3p	HITS-CLIP	23824327
MIRT627173	hsa-miR-5096	HITS-CLIP	23824327
MIRT627172	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT627179	hsa-miR-892a	HITS-CLIP	23824327
MIRT627178	hsa-miR-6760-3p	HITS-CLIP	23824327
MIRT627177	hsa-miR-181b-2-3p	HITS-CLIP	23824327
MIRT627176	hsa-miR-181b-3p	HITS-CLIP	23824327
MIRT627175	hsa-miR-4420	HITS-CLIP	23824327
MIRT627174	hsa-miR-653-3p	HITS-CLIP	23824327
MIRT627173	hsa-miR-5096	HITS-CLIP	23824327
MIRT627172	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT441707	hsa-miR-105-5p	PAR-CLIP	22100165
MIRT441704	hsa-miR-7853-5p	PAR-CLIP	22100165
MIRT441705	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT1513468	hsa-miR-103a	CLIP-seq
MIRT1513469	hsa-miR-107	CLIP-seq
MIRT1513470	hsa-miR-1301	CLIP-seq
MIRT1513471	hsa-miR-2278	CLIP-seq
MIRT1513472	hsa-miR-369-3p	CLIP-seq
MIRT1513473	hsa-miR-374a	CLIP-seq
MIRT1513474	hsa-miR-374b	CLIP-seq
MIRT1513475	hsa-miR-4468	CLIP-seq
MIRT1513476	hsa-miR-450b-5p	CLIP-seq
MIRT1513477	hsa-miR-5047	CLIP-seq
MIRT1513478	hsa-miR-507	CLIP-seq
MIRT1513479	hsa-miR-557	CLIP-seq
MIRT1513480	hsa-miR-140-3p	CLIP-seq
MIRT1513481	hsa-miR-1587	CLIP-seq
MIRT1513482	hsa-miR-205	CLIP-seq
MIRT1513483	hsa-miR-2467-3p	CLIP-seq
MIRT1513484	hsa-miR-3119	CLIP-seq
MIRT1513485	hsa-miR-3163	CLIP-seq
MIRT1513486	hsa-miR-329	CLIP-seq
MIRT1513487	hsa-miR-3620	CLIP-seq
MIRT1513488	hsa-miR-362-3p	CLIP-seq
MIRT1513489	hsa-miR-3675-3p	CLIP-seq
MIRT1513490	hsa-miR-4257	CLIP-seq
MIRT1513491	hsa-miR-4492	CLIP-seq
MIRT1513492	hsa-miR-4498	CLIP-seq
MIRT1513493	hsa-miR-4524	CLIP-seq
MIRT1513494	hsa-miR-4656	CLIP-seq
MIRT1513495	hsa-miR-4674	CLIP-seq
MIRT1513496	hsa-miR-4675	CLIP-seq
MIRT1513497	hsa-miR-4741	CLIP-seq
MIRT1513498	hsa-miR-635	CLIP-seq
MIRT1513499	hsa-miR-762	CLIP-seq
MIRT1513500	hsa-miR-1243	CLIP-seq
MIRT1513501	hsa-miR-144	CLIP-seq
MIRT1513502	hsa-miR-185	CLIP-seq
MIRT1513503	hsa-miR-3654	CLIP-seq
MIRT1513504	hsa-miR-4306	CLIP-seq
MIRT1513505	hsa-miR-4644	CLIP-seq
MIRT1513506	hsa-miR-4645-3p	CLIP-seq
MIRT1513507	hsa-miR-542-3p	CLIP-seq
MIRT2154751	hsa-miR-4260	CLIP-seq
MIRT2154752	hsa-miR-4744	CLIP-seq
MIRT2441794	hsa-miR-296-5p	CLIP-seq
MIRT2441795	hsa-miR-544	CLIP-seq
MIRT2667364	hsa-miR-1245b-3p	CLIP-seq
MIRT2667365	hsa-miR-1276	CLIP-seq
MIRT2667366	hsa-miR-1305	CLIP-seq
MIRT2667367	hsa-miR-147	CLIP-seq
MIRT2667368	hsa-miR-3133	CLIP-seq
MIRT2667369	hsa-miR-3201	CLIP-seq
MIRT2667370	hsa-miR-3682-3p	CLIP-seq
MIRT2667371	hsa-miR-3684	CLIP-seq
MIRT2667372	hsa-miR-3691-5p	CLIP-seq
MIRT2667373	hsa-miR-3911	CLIP-seq
MIRT2667374	hsa-miR-3924	CLIP-seq
MIRT2667375	hsa-miR-4302	CLIP-seq
MIRT2667376	hsa-miR-4311	CLIP-seq
MIRT2667377	hsa-miR-4431	CLIP-seq
MIRT2667378	hsa-miR-4432	CLIP-seq
MIRT2667379	hsa-miR-452	CLIP-seq
MIRT2667380	hsa-miR-4676-3p	CLIP-seq
MIRT2154752	hsa-miR-4744	CLIP-seq
MIRT2667381	hsa-miR-4752	CLIP-seq
MIRT2667382	hsa-miR-4791	CLIP-seq
MIRT2667383	hsa-miR-548b-3p	CLIP-seq
MIRT2667384	hsa-miR-561	CLIP-seq
MIRT2667385	hsa-miR-583	CLIP-seq
MIRT2667386	hsa-miR-644	CLIP-seq
MIRT2667378	hsa-miR-4432	CLIP-seq
MIRT2667379	hsa-miR-452	CLIP-seq
MIRT2667380	hsa-miR-4676-3p	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007417	Process	Central nervous system development	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
608948	20393	ENSG00000174963

Q8N9L1

Protein name

Zinc finger protein ZIC 4 (Zinc finger protein of the cerebellum 4)

Protein function

Binds to DNA.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18366	zf_ZIC	121 → 166	Zic proteins zinc finger domain	Domain
PF00096	zf-C2H2	204 → 228	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	264 → 288	Zinc finger, C2H2 type	Domain

Sequence

MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLN
GLLRLGLPGDMYARPEPFPPGPAARSDALAAAAALHGYGGMNLTVNLAAPHGPGAFFRYM
RQPIKQELICKWLAADGTATPSLCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPR
QGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEG
CERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS
ATPSALVSPSSDCGHKSQVASSAAVAARTADLSE

Sequence length

334

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (36)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Blepharophimosis	Blepharophimosis	BEFREE	21471554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	BEFREE	21471554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	31396565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carnitine palmitoyl transferase 1A deficiency	Carnitine palmitoyltransferase deficiency	Pubtator	39266576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	32943444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar Diseases	BEFREE	12499499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	15007130	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	32943444, 35997131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	BEFREE	26340333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	BEFREE	21471554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	BEFREE	15338008, 21204220, 21307096, 23679990, 29442326, 30391508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dandy-Walker Syndrome	Dandy-Walker Syndrome	LHGDN	15338008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	21307096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	17936758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30621721, 31427569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34475426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	21471554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24786473, 27553089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated Dandy-Walker malformation with hydrocephalus	Isolated Dandy-Walker Malformation With Hydrocephalus	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated Dandy-Walker malformation without hydrocephalus	Isolated Dandy-Walker Malformation Without Hydrocephalus	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	27553089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24786473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27553089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	35997131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23774800, 27553089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	27553089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23202957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	39266576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	35997131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	18639938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	21471554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	18639938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15007130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27553089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	22284968		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZIC4 (Zic family zinc finger 4)