MND1 (meiotic nuclear divisions 1)

Gene

• Entrez ID: 84057
• Gene name: Meiotic nuclear divisions 1
• Gene symbol: MND1
• Synonyms (NCBI Gene): GAJ
• Chromosome: 4
• Chromosome location: 4q31.3
• Summary: The product of the MND1 gene associates with HOP2 (MIM 608665) to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 (MIM 179617) and DMC1 (MIM 602721) (Chi et al., 2007 [PubMed 17639080]). Both the MND1 an

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016462	hsa-miR-193b-3p	Microarray	20304954
MIRT1153863	hsa-miR-1193	CLIP-seq
MIRT1153864	hsa-miR-1246	CLIP-seq
MIRT1153865	hsa-miR-1273f	CLIP-seq
MIRT1153866	hsa-miR-1290	CLIP-seq
MIRT1153867	hsa-miR-205	CLIP-seq
MIRT1153868	hsa-miR-2355-3p	CLIP-seq
MIRT1153869	hsa-miR-3134	CLIP-seq
MIRT1153870	hsa-miR-3167	CLIP-seq
MIRT1153871	hsa-miR-3201	CLIP-seq
MIRT1153872	hsa-miR-3663-3p	CLIP-seq
MIRT1153873	hsa-miR-4282	CLIP-seq
MIRT1153874	hsa-miR-4457	CLIP-seq
MIRT1153875	hsa-miR-4525	CLIP-seq
MIRT1153876	hsa-miR-4791	CLIP-seq
MIRT1153877	hsa-miR-4793-5p	CLIP-seq
MIRT1153878	hsa-miR-513b	CLIP-seq
MIRT1153879	hsa-miR-577	CLIP-seq
MIRT1153880	hsa-miR-584	CLIP-seq
MIRT1153881	hsa-miR-633	CLIP-seq
MIRT1153882	hsa-miR-637	CLIP-seq
MIRT1153883	hsa-miR-676	CLIP-seq
MIRT1153884	hsa-miR-876-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16407260, 26496610, 28514442, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0006310	Process	DNA recombination	IEA
GO:0007129	Process	Homologous chromosome pairing at meiosis	IDA	16407260
GO:0007131	Process	Reciprocal meiotic recombination	IBA
GO:0007131	Process	Reciprocal meiotic recombination	IDA	16407260
GO:0007131	Process	Reciprocal meiotic recombination	IEA
GO:0051321	Process	Meiotic cell cycle	IEA

Other IDs

• MIM: 611422
• HGNC: 24839
• e!Ensembl: ENSG00000121211

Protein

• UniProt ID: Q9BWT6
• Protein name: Meiotic nuclear division protein 1 homolog
• Protein function: Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis (By similarity). Stimulates both DMC1- and RAD51-mediated homologous strand assimilation, which is required for the resolution
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03962	Mnd1	16 → 75	Mnd1 HTH domain	Domain
  PF18517	LZ3wCH	150 → 204	Leucine zipper with capping helix domain	Domain

• Sequence:

  MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMV
  DCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEER
  TRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWA
  KRKFGFEENKIDRTFGIPEDFDYID

• Sequence length: 205

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APPENDICITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF APPENDIX	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Azoospermia	Azoospermia	Pubtator	23675907	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39191147	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	39191147	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36352167	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36098680	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33941804	Associate	★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	23675907		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39191147	Stimulate	★☆☆☆☆ Found in Text Mining only