Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8405
Gene name	Speckle type BTB/POZ protein
Gene symbol	SPOP
Synonyms (NCBI Gene)	BTBD32NEDMACENEDMIDFNSDVS1NSDVS2TEF2
Chromosome	17
Chromosome location	17q21.33
Summary	This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein bin

226

Show/Hide all (226)

miRTarBase ID	miRNA	Experiments	Reference
MIRT644598	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT644597	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT644596	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT644595	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT644594	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT644593	hsa-miR-3182	HITS-CLIP	23824327
MIRT644592	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT644591	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT644590	hsa-miR-539-5p	HITS-CLIP	23824327
MIRT644589	hsa-miR-548aj-5p	HITS-CLIP	23824327
MIRT644588	hsa-miR-548f-5p	HITS-CLIP	23824327
MIRT644587	hsa-miR-548g-5p	HITS-CLIP	23824327
MIRT644586	hsa-miR-548x-5p	HITS-CLIP	23824327
MIRT644585	hsa-miR-1468-3p	HITS-CLIP	23824327
MIRT644584	hsa-miR-623	HITS-CLIP	23824327
MIRT644583	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT644582	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT644581	hsa-miR-548aw	HITS-CLIP	23824327
MIRT644580	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT644579	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT644578	hsa-miR-544a	HITS-CLIP	23824327
MIRT644577	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT644576	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT644575	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT644574	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT644573	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT644572	hsa-miR-4282	HITS-CLIP	23824327
MIRT644571	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT644570	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT644569	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT644568	hsa-miR-3163	HITS-CLIP	23824327
MIRT644567	hsa-miR-1248	HITS-CLIP	23824327
MIRT644566	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT644565	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT644564	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT644563	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT644562	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT644561	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT644560	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT644559	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT644558	hsa-miR-3161	HITS-CLIP	23824327
MIRT644557	hsa-miR-4273	HITS-CLIP	23824327
MIRT644555	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT644556	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT644554	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT644553	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT644552	hsa-miR-599	HITS-CLIP	23824327
MIRT644551	hsa-miR-375	HITS-CLIP	23824327
MIRT644550	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT644549	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT644548	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT644547	hsa-miR-4759	HITS-CLIP	23824327
MIRT644546	hsa-miR-3169	HITS-CLIP	23824327
MIRT644545	hsa-miR-8083	HITS-CLIP	23824327
MIRT644544	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT644543	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT644541	hsa-miR-8063	HITS-CLIP	23824327
MIRT644542	hsa-miR-4698	HITS-CLIP	23824327
MIRT644540	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT644539	hsa-miR-3117-3p	HITS-CLIP	23824327
MIRT644538	hsa-miR-4503	HITS-CLIP	23824327
MIRT734550	hsa-miR-145-5p	ImmunofluorescenceqRT-PCR	32512734
MIRT644598	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT644597	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT644596	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT644595	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT644594	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT644593	hsa-miR-3182	HITS-CLIP	23824327
MIRT644592	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT644591	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT644590	hsa-miR-539-5p	HITS-CLIP	23824327
MIRT644589	hsa-miR-548aj-5p	HITS-CLIP	23824327
MIRT644588	hsa-miR-548f-5p	HITS-CLIP	23824327
MIRT644587	hsa-miR-548g-5p	HITS-CLIP	23824327
MIRT644586	hsa-miR-548x-5p	HITS-CLIP	23824327
MIRT644585	hsa-miR-1468-3p	HITS-CLIP	23824327
MIRT644584	hsa-miR-623	HITS-CLIP	23824327
MIRT644583	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT644582	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT644581	hsa-miR-548aw	HITS-CLIP	23824327
MIRT644580	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT644579	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT644578	hsa-miR-544a	HITS-CLIP	23824327
MIRT644577	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT644576	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT644575	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT644574	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT644573	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT644572	hsa-miR-4282	HITS-CLIP	23824327
MIRT644571	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT644570	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT644569	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT644568	hsa-miR-3163	HITS-CLIP	23824327
MIRT644567	hsa-miR-1248	HITS-CLIP	23824327
MIRT644566	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT644565	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT644564	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT644563	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT644562	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT644561	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT644560	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT644559	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT644558	hsa-miR-3161	HITS-CLIP	23824327
MIRT644557	hsa-miR-4273	HITS-CLIP	23824327
MIRT644555	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT644556	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT644554	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT644553	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT644552	hsa-miR-599	HITS-CLIP	23824327
MIRT644551	hsa-miR-375	HITS-CLIP	23824327
MIRT644550	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT644549	hsa-miR-4668-3p	HITS-CLIP	23824327
MIRT644548	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT644547	hsa-miR-4759	HITS-CLIP	23824327
MIRT644546	hsa-miR-3169	HITS-CLIP	23824327
MIRT644545	hsa-miR-8083	HITS-CLIP	23824327
MIRT644544	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT644543	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT644541	hsa-miR-8063	HITS-CLIP	23824327
MIRT644542	hsa-miR-4698	HITS-CLIP	23824327
MIRT644540	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT644539	hsa-miR-3117-3p	HITS-CLIP	23824327
MIRT644538	hsa-miR-4503	HITS-CLIP	23824327
MIRT1385206	hsa-miR-297	CLIP-seq
MIRT1385207	hsa-miR-3127-3p	CLIP-seq
MIRT1385208	hsa-miR-3149	CLIP-seq
MIRT1385209	hsa-miR-3154	CLIP-seq
MIRT1385210	hsa-miR-3173-3p	CLIP-seq
MIRT1385211	hsa-miR-3180-5p	CLIP-seq
MIRT1385212	hsa-miR-323-5p	CLIP-seq
MIRT1385213	hsa-miR-3671	CLIP-seq
MIRT1385214	hsa-miR-3691-3p	CLIP-seq
MIRT1385215	hsa-miR-4428	CLIP-seq
MIRT1385216	hsa-miR-4719	CLIP-seq
MIRT1385217	hsa-miR-5096	CLIP-seq
MIRT1385218	hsa-miR-513b	CLIP-seq
MIRT1385219	hsa-miR-520a-5p	CLIP-seq
MIRT1385220	hsa-miR-525-5p	CLIP-seq
MIRT1385221	hsa-miR-643	CLIP-seq
MIRT1385222	hsa-miR-876-3p	CLIP-seq
MIRT1385223	hsa-miR-1299	CLIP-seq
MIRT1385224	hsa-miR-1470	CLIP-seq
MIRT1385225	hsa-miR-3168	CLIP-seq
MIRT1385212	hsa-miR-323-5p	CLIP-seq
MIRT1385226	hsa-miR-338-5p	CLIP-seq
MIRT1385227	hsa-miR-3618	CLIP-seq
MIRT1385228	hsa-miR-3919	CLIP-seq
MIRT1385229	hsa-miR-3925-5p	CLIP-seq
MIRT1385230	hsa-miR-4294	CLIP-seq
MIRT1385231	hsa-miR-4456	CLIP-seq
MIRT1385232	hsa-miR-4667-3p	CLIP-seq
MIRT1385233	hsa-miR-4697-3p	CLIP-seq
MIRT1385234	hsa-miR-4709-5p	CLIP-seq
MIRT1385235	hsa-miR-4782-5p	CLIP-seq
MIRT1385236	hsa-miR-516b	CLIP-seq
MIRT1385237	hsa-miR-548ac	CLIP-seq
MIRT1385238	hsa-miR-548ae	CLIP-seq
MIRT1385239	hsa-miR-548aj	CLIP-seq
MIRT1385240	hsa-miR-548am	CLIP-seq
MIRT1385241	hsa-miR-548d-3p	CLIP-seq
MIRT1385242	hsa-miR-548x	CLIP-seq
MIRT1385243	hsa-miR-548z	CLIP-seq
MIRT1385244	hsa-miR-553	CLIP-seq
MIRT1385245	hsa-miR-579	CLIP-seq
MIRT1385246	hsa-miR-589	CLIP-seq
MIRT1385247	hsa-miR-604	CLIP-seq
MIRT1385248	hsa-miR-619	CLIP-seq
MIRT1385249	hsa-miR-642a	CLIP-seq
MIRT1385250	hsa-miR-647	CLIP-seq
MIRT1385251	hsa-miR-875-3p	CLIP-seq
MIRT1385222	hsa-miR-876-3p	CLIP-seq
MIRT1385252	hsa-miR-885-3p	CLIP-seq
MIRT1385253	hsa-miR-934	CLIP-seq
MIRT2115276	hsa-miR-1236	CLIP-seq
MIRT1385223	hsa-miR-1299	CLIP-seq
MIRT2115277	hsa-miR-3152-5p	CLIP-seq
MIRT1385211	hsa-miR-3180-5p	CLIP-seq
MIRT1385212	hsa-miR-323-5p	CLIP-seq
MIRT2115278	hsa-miR-3591-5p	CLIP-seq
MIRT2115279	hsa-miR-3614-5p	CLIP-seq
MIRT1385230	hsa-miR-4294	CLIP-seq
MIRT2115280	hsa-miR-4297	CLIP-seq
MIRT1385231	hsa-miR-4456	CLIP-seq
MIRT2115281	hsa-miR-4473	CLIP-seq
MIRT2115282	hsa-miR-4671-3p	CLIP-seq
MIRT1385233	hsa-miR-4697-3p	CLIP-seq
MIRT1385234	hsa-miR-4709-5p	CLIP-seq
MIRT2115283	hsa-miR-4774-3p	CLIP-seq
MIRT1385235	hsa-miR-4782-5p	CLIP-seq
MIRT1385236	hsa-miR-516b	CLIP-seq
MIRT1385244	hsa-miR-553	CLIP-seq
MIRT2115284	hsa-miR-600	CLIP-seq
MIRT1385247	hsa-miR-604	CLIP-seq
MIRT2115285	hsa-miR-616	CLIP-seq
MIRT1385248	hsa-miR-619	CLIP-seq
MIRT1385250	hsa-miR-647	CLIP-seq
MIRT1385251	hsa-miR-875-3p	CLIP-seq
MIRT1385222	hsa-miR-876-3p	CLIP-seq
MIRT1385252	hsa-miR-885-3p	CLIP-seq
MIRT2115286	hsa-miR-924	CLIP-seq
MIRT1385212	hsa-miR-323-5p	CLIP-seq
MIRT1385235	hsa-miR-4782-5p	CLIP-seq
MIRT2440775	hsa-miR-1305	CLIP-seq
MIRT2440776	hsa-miR-145	CLIP-seq
MIRT1385211	hsa-miR-3180-5p	CLIP-seq
MIRT2440777	hsa-miR-3591-3p	CLIP-seq
MIRT2440778	hsa-miR-421	CLIP-seq
MIRT2440779	hsa-miR-4328	CLIP-seq
MIRT2440775	hsa-miR-1305	CLIP-seq
MIRT2440776	hsa-miR-145	CLIP-seq
MIRT1385211	hsa-miR-3180-5p	CLIP-seq
MIRT2440777	hsa-miR-3591-3p	CLIP-seq
MIRT2440778	hsa-miR-421	CLIP-seq
MIRT2440779	hsa-miR-4328	CLIP-seq
MIRT1385211	hsa-miR-3180-5p	CLIP-seq
MIRT1385213	hsa-miR-3671	CLIP-seq
MIRT1385214	hsa-miR-3691-3p	CLIP-seq
MIRT1385216	hsa-miR-4719	CLIP-seq
MIRT1385217	hsa-miR-5096	CLIP-seq
MIRT1385218	hsa-miR-513b	CLIP-seq
MIRT1385219	hsa-miR-520a-5p	CLIP-seq
MIRT1385220	hsa-miR-525-5p	CLIP-seq
MIRT1385211	hsa-miR-3180-5p	CLIP-seq
MIRT1385213	hsa-miR-3671	CLIP-seq
MIRT1385219	hsa-miR-520a-5p	CLIP-seq
MIRT1385220	hsa-miR-525-5p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	14528312
GO:0005515	Function	Protein binding	IPI	16189514, 21573799, 21577200, 21988832, 22632832, 24656772, 28514442, 33961781, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22085717
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9414087
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0030162	Process	Regulation of proteolysis	IBA
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IDA	14528312, 22085717
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0042802	Function	Identical protein binding	IPI	22632832, 35512704
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	22085717, 32109420
GO:0140678	Function	Molecular function inhibitor activity	EXP	31624231

MIM	HGNC	e!Ensembl
602650	11254	ENSG00000121067

O43791

Protein name

Speckle-type POZ protein (HIB homolog 1) (Roadkill homolog 1)

Protein function

Component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, leading most often to their proteasomal degradation. In complex with CUL3, involved in ubiquitination a

PDB

2CR2 , 3HQH , 3HQI , 3HQL , 3HQM , 3HSV , 3HTM , 3HU6 , 3IVB , 3IVQ , 3IVV , 4EOZ , 4HS2 , 4J8Z , 4O1V , 6F8F , 6F8G , 6I41 , 6I5P , 6I68 , 6I7A , 7D3D , 7KLZ , 7LIN , 7LIO , 7LIP , 7LIQ , 8DWS , 8DWT , 8DWU , 8DWV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00917	MATH	38 → 163	MATH domain	Domain
PF00651	BTB	190 → 297	BTB/POZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9414087}.

Sequence

MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS

Sequence length

374

Interactions

View interactions

	KEGG		Reactome
	Hedgehog signaling pathway		Hedgehog 'on' state

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Nabais Sa-de Vries syndrome	Likely pathogenic	rs2543841231	RCV003335885	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder with microcephaly and dysmorphic facies	Likely pathogenic; Pathogenic	rs2143269972, rs2072157379, rs2072153488	RCV002249179 RCV001030767 RCV001030768	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder with relative macrocephaly and with or without cardiac or endocrine anomalies	Likely pathogenic; Pathogenic	rs2143268856, rs2072155694, rs968974699, rs2072168176	RCV003224990 RCV001030769 RCV001030771 RCV001030772	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SPOP-related disorder	Likely pathogenic	rs2143295744	RCV003968584	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SPOP-related neurodevelopmental condition	Likely pathogenic; Pathogenic	rs2143273650	RCV001788995	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Squamous cell carcinoma of the head and neck	Likely pathogenic	rs2143295744	RCV005922740	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, DUCTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROCEPHALY-HEARING LOSS-FACIAL DYSMORPHISM-INTELLECTUAL DISABILITY SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	Conflicting classifications of pathogenicity; -; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (90)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	25274033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31105033, 31392082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	25274033, 28414305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	31776466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32345668, 32568785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	29523594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	30882175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	22688887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22085717, 23559371, 26505385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23559371, 30244836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	31577764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27780719, 28599312, 30237511, 33247697, 34987184, 35438056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34509929	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26156804, 37996058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of endometrium	Endometrial carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31392082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28718916, 33602681, 36474188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30197334	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31819473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	19164706, 27572476, 30197334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23216165, 26022775, 28032859, 29260353, 30171794, 30674532, 31772275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26505385, 28599312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	32109420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	24451148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	23559371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24656772, 27572476, 27622336, 30197334, 30348808, 31577764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	32109420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31776466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	CTD_human_DG	29295717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	23104009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25058385, 25766326, 28805821, 29461588, 29546395, 31495053, 31776466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	23104009		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23104009, 25766326, 28485815, 33602681, 36481790, 37904149	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31819473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	32109420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	23216165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	27494611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37382594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22688887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25351530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	Pubtator	31126914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	24912477, 26156804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	26156804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	32109420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26156804, 29777712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28073696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36042498	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21577200, 22085717, 23559371, 26505385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25766326, 28805821, 29546395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19164706, 24656772, 27622336, 29128526, 31495053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26156804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31392082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31819473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22610119, 23216165, 23559371, 24508459, 24563616, 24796539, 24990631, 24994784, 24998678, 25056375, 25058385, 25204806, 25274033, 25278611, 27238081 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	22610119, 29295717, 29610475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25204354, 30174445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23216165, 25058385, 25204354, 26156804, 28805821, 28928843, 29128526, 29160310, 29260353, 29546395, 30244836, 30290146, 30595538, 31270456, 31495053 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Uterine Corpus Neoplasm	Malignant Uterine Corpus Neoplasm	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	32109420	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19164706, 21577200, 22610119, 23216165, 23559371, 24451148, 24912477, 24994784, 25204354, 25274033, 25351530, 26156804, 26527005, 26544944, 28089830 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28073696, 28927035, 30190126, 30407707, 30607139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29461588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29461588	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31819473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	31493386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	24796539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	24796539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22610119, 23216165, 23559371, 24508459, 24563616, 24796539, 24990631, 24994784, 24998678, 25056375, 25058385, 25204806, 25274033, 25278611, 27238081 View all (28 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	26542946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	22610119, 29295717, 29610475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22610119, 23559371, 24508459, 24563616, 24796539, 24969063, 24994784, 25201530, 25274033, 25278611, 26344095, 26344096, 26542946, 26544944, 27780719 View all (42 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	24994784, 26527005, 29202479, 31090082		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24994784, 30237511	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	19164706, 24656772, 27622336, 29128526, 31495053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19164706, 27572476, 30197334, 30348808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	19164706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31298378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25204354, 30174445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35325318	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38246227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	27494611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30002443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35194034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36042498	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SPOP (speckle type BTB/POZ protein)