Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8402
Gene name	Solute carrier family 25 member 11
Gene symbol	SLC25A11
Synonyms (NCBI Gene)	OGCPGL6PPGL6SLC20A4
Chromosome	17
Chromosome location	17p13.2
Summary	The oxoglutarate/malate carrier transports 2-oxoglutarate across the inner membranes of mitochondria in an electroneutral exchange for malate or other dicarboxylic acids (summary by Iacobazzi et al., 1992 [PubMed 1457818]).[supplied by OMIM, Jan 2011]

174

Show/Hide all (174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT612487	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT612486	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT612485	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT612484	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT612483	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT612482	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT612481	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT612480	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612479	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT612478	hsa-miR-3176	HITS-CLIP	23824327
MIRT612477	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT612476	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT612487	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT612486	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT612485	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT612484	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT612483	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT612482	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT612481	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT612480	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612479	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT612478	hsa-miR-3176	HITS-CLIP	23824327
MIRT612477	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT612476	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT612487	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT612486	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT612485	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT612484	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT612483	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT612482	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT612481	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT612480	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612479	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT612478	hsa-miR-3176	HITS-CLIP	23824327
MIRT612477	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT612476	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT612487	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT612486	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT612485	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT612484	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT612483	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT612482	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT612481	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT612480	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612479	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT612478	hsa-miR-3176	HITS-CLIP	23824327
MIRT612477	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT612476	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT612487	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT612486	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT612485	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT612484	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT612483	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT612482	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT612481	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT612480	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612479	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT612478	hsa-miR-3176	HITS-CLIP	23824327
MIRT612477	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT612476	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT612487	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT612486	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT612485	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT612484	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT612483	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT612482	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT612481	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT612480	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612479	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT612478	hsa-miR-3176	HITS-CLIP	23824327
MIRT612477	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT612476	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT612487	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT612486	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT612485	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT612484	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT612483	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT612482	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT612481	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT612480	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612479	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT612478	hsa-miR-3176	HITS-CLIP	23824327
MIRT612477	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT612476	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT612487	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT612486	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT612485	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT612484	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT612483	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT612482	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT612481	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT612480	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT612479	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT612478	hsa-miR-3176	HITS-CLIP	23824327
MIRT612477	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT612476	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT1355109	hsa-miR-1184	CLIP-seq
MIRT1355110	hsa-miR-1205	CLIP-seq
MIRT1355111	hsa-miR-146b-3p	CLIP-seq
MIRT1355112	hsa-miR-1914	CLIP-seq
MIRT1355113	hsa-miR-3158-5p	CLIP-seq
MIRT1355114	hsa-miR-3173-5p	CLIP-seq
MIRT1355115	hsa-miR-3182	CLIP-seq
MIRT1355116	hsa-miR-3184	CLIP-seq
MIRT1355117	hsa-miR-3202	CLIP-seq
MIRT1355118	hsa-miR-423-5p	CLIP-seq
MIRT1355119	hsa-miR-4287	CLIP-seq
MIRT1355120	hsa-miR-4469	CLIP-seq
MIRT1355121	hsa-miR-4476	CLIP-seq
MIRT1355122	hsa-miR-4477a	CLIP-seq
MIRT1355123	hsa-miR-4685-3p	CLIP-seq
MIRT1355124	hsa-miR-4716-3p	CLIP-seq
MIRT1355125	hsa-miR-4723-5p	CLIP-seq
MIRT1355126	hsa-miR-4738-3p	CLIP-seq
MIRT1355127	hsa-miR-548aa	CLIP-seq
MIRT1355128	hsa-miR-626	CLIP-seq
MIRT1355129	hsa-miR-642a	CLIP-seq
MIRT1355130	hsa-miR-874	CLIP-seq
MIRT1355111	hsa-miR-146b-3p	CLIP-seq
MIRT2623951	hsa-miR-1909	CLIP-seq
MIRT1355112	hsa-miR-1914	CLIP-seq
MIRT2623952	hsa-miR-1915	CLIP-seq
MIRT2623953	hsa-miR-2276	CLIP-seq
MIRT2623954	hsa-miR-3132	CLIP-seq
MIRT2623955	hsa-miR-3135b	CLIP-seq
MIRT1355114	hsa-miR-3173-5p	CLIP-seq
MIRT2623956	hsa-miR-3180-5p	CLIP-seq
MIRT1355115	hsa-miR-3182	CLIP-seq
MIRT2623957	hsa-miR-320e	CLIP-seq
MIRT2623958	hsa-miR-3691-3p	CLIP-seq
MIRT2623959	hsa-miR-3919	CLIP-seq
MIRT2623960	hsa-miR-4267	CLIP-seq
MIRT2623961	hsa-miR-4436a	CLIP-seq
MIRT2623962	hsa-miR-4650-3p	CLIP-seq
MIRT2623963	hsa-miR-4662a-5p	CLIP-seq
MIRT2623964	hsa-miR-4696	CLIP-seq
MIRT1355124	hsa-miR-4716-3p	CLIP-seq
MIRT1355125	hsa-miR-4723-5p	CLIP-seq
MIRT1355126	hsa-miR-4738-3p	CLIP-seq
MIRT2623965	hsa-miR-4772-5p	CLIP-seq
MIRT2623966	hsa-miR-4773	CLIP-seq
MIRT2623967	hsa-miR-513a-5p	CLIP-seq
MIRT2623968	hsa-miR-539	CLIP-seq
MIRT1355127	hsa-miR-548aa	CLIP-seq
MIRT1355128	hsa-miR-626	CLIP-seq
MIRT1355130	hsa-miR-874	CLIP-seq
MIRT1355111	hsa-miR-146b-3p	CLIP-seq
MIRT2623951	hsa-miR-1909	CLIP-seq
MIRT1355112	hsa-miR-1914	CLIP-seq
MIRT2623952	hsa-miR-1915	CLIP-seq
MIRT2623953	hsa-miR-2276	CLIP-seq
MIRT2623954	hsa-miR-3132	CLIP-seq
MIRT2623955	hsa-miR-3135b	CLIP-seq
MIRT1355114	hsa-miR-3173-5p	CLIP-seq
MIRT2623956	hsa-miR-3180-5p	CLIP-seq
MIRT1355115	hsa-miR-3182	CLIP-seq
MIRT2623957	hsa-miR-320e	CLIP-seq
MIRT2623958	hsa-miR-3691-3p	CLIP-seq
MIRT2623959	hsa-miR-3919	CLIP-seq
MIRT2623960	hsa-miR-4267	CLIP-seq
MIRT2623961	hsa-miR-4436a	CLIP-seq
MIRT2623962	hsa-miR-4650-3p	CLIP-seq
MIRT2623963	hsa-miR-4662a-5p	CLIP-seq
MIRT2623964	hsa-miR-4696	CLIP-seq
MIRT1355124	hsa-miR-4716-3p	CLIP-seq
MIRT1355125	hsa-miR-4723-5p	CLIP-seq
MIRT1355126	hsa-miR-4738-3p	CLIP-seq
MIRT2623965	hsa-miR-4772-5p	CLIP-seq
MIRT2623966	hsa-miR-4773	CLIP-seq
MIRT2623967	hsa-miR-513a-5p	CLIP-seq
MIRT2623968	hsa-miR-539	CLIP-seq
MIRT1355127	hsa-miR-548aa	CLIP-seq
MIRT1355128	hsa-miR-626	CLIP-seq
MIRT1355130	hsa-miR-874	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	32814053, 37009826
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS	1457818
GO:0005886	Component	Plasma membrane	TAS	1457818
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IEA
GO:0015297	Function	Antiporter activity	IEA
GO:0015367	Function	Oxoglutarate:malate antiporter activity	IEA
GO:0015367	Function	Oxoglutarate:malate antiporter activity	TAS	1457818
GO:0015742	Process	Alpha-ketoglutarate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0043490	Process	Malate-aspartate shuttle	IEA
GO:0043490	Process	Malate-aspartate shuttle	IMP	37647199
GO:0055085	Process	Transmembrane transport	IEA
GO:0071423	Process	Malate transmembrane transport	IEA

MIM	HGNC	e!Ensembl
604165	10981	ENSG00000108528

Q02978

Protein name

Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP) (alpha-oxoglutarate carrier) (Solute carrier family 25 member 11) (SLC25A11)

Protein function

Catalyzes the transport of 2-oxoglutarate (alpha-oxoglutarate) across the inner mitochondrial membrane in an electroneutral exchange for malate. Can also exchange 2-oxoglutarate for other dicarboxylic acids such as malonate, succinate, maleate a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	18 → 112	Mitochondrial carrier protein	Family
PF00153	Mito_carr	115 → 213	Mitochondrial carrier protein	Family
PF00153	Mito_carr	216 → 311	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Most highly expressed in the heart. {ECO:0000269|PubMed:21448454}.

Sequence

MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTRE
YKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL
LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTL
WRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV
DIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL
EQMNKAYKRLFLSG

Sequence length

314

Interactions

View interactions

	Reactome
			Gluconeogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Pheochromocytoma/paraganglioma syndrome 6	Pathogenic	rs1567650859, rs1203876038, rs1567650874, rs1567651815, rs1374026152	RCV000785991 RCV000785992 RCV000785993 RCV000785994 RCV000785995	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC25A11-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary hemangioma of retina	Capillary Hemangioma Of Retina	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32555317	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37009826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranial nerve compression	Cranial nerve compression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic paroxysmal anxiety	Episodic paroxysmal anxiety	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pheochromocytoma-paraganglioma	Hereditary Pheochromocytoma-Paraganglioma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive Retinopathy	Hypertensive Retinopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	31474003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28942194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30686754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28942194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30686754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28942194, 30686754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30686754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36514121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma of head and neck	Paraganglioma of head and neck	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulsatile Tinnitus	Pulsatile Tinnitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Tachycardia	Sinus Tachycardia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Vocal Cord Paralysis	Vocal Cord Paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC25A11 (solute carrier family 25 member 11)