Gene Gene information from NCBI Gene database.
Entrez ID 83937
Gene name Ras association domain family member 4
Gene symbol RASSF4
Synonyms (NCBI Gene)
AD037
Chromosome 10
Chromosome location 10q11.21
Summary The function of this gene has not yet been determined but may involve a role in tumor suppression. Alternative splicing of this gene results in several transcript variants; however, most of the variants have not been fully described. [provided by RefSeq,
miRNA miRNA information provided by mirtarbase database.
395
miRTarBase ID miRNA Experiments Reference
MIRT607787 hsa-miR-8485 HITS-CLIP 23313552
MIRT607786 hsa-miR-626 HITS-CLIP 23313552
MIRT607785 hsa-miR-6876-3p HITS-CLIP 23313552
MIRT607787 hsa-miR-8485 HITS-CLIP 23824327
MIRT631495 hsa-miR-922 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20562859, 20920251, 23455922, 24255178, 24366813, 25416956, 32296183, 35271311
GO:0007165 Process Signal transduction IBA
GO:0007165 Process Signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610559 20793 ENSG00000107551
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H2L5
Protein name Ras association domain-containing protein 4
Protein function Potential tumor suppressor. May act as a KRAS effector protein. May promote apoptosis and cell cycle arrest.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00788 RA 174 261 Ras association (RalGDS/AF-6) domain Domain
PF16517 Nore1-SARAH 275 314 Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Frequently down-regulated in tumor cell lines. {ECO:0000269|PubMed:15574778}.
Sequence
MKEDCLPSSHVPISDSKSIQKSELLGLLKTYNCYHEGKSFQLRHREEEGTLIIEGLLNIA
WGLRRPIRLQMQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESS
TDSSGPLEEAEEAPQLMRTKSDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTSV
FTPAYGSVTNVRVNSTMTTLQVLTLLLNKFRVEDGPSEFALYIVHESGERTKLKDCEYPL
ISRILHGPCEKIARIFLMEAD
LGVEVPHEVAQYIKFEMPVLDSFVEKLKEEEEREIIKLT
MKFQALRLTMLQRL
EQLVEAK
Sequence length 321
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Hippo signaling pathway - multiple species  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alveolar rhabdomyosarcoma Alveolar Rhabdomyosarcoma BEFREE 24334454, 31508857
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 28600435 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 26526576
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 35611809 Inhibit
★☆☆☆☆
Found in Text Mining only
Glioma Glioma BEFREE 14743209
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 26526576 Inhibit
★☆☆☆☆
Found in Text Mining only
Malignant Childhood Neoplasm Malignant Neoplasm BEFREE 31508857
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer BEFREE 26526576
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 26526576, 29259009
★☆☆☆☆
Found in Text Mining only
Melanoma Melanoma Pubtator 30672666 Associate
★☆☆☆☆
Found in Text Mining only