FGFBP2 (fibroblast growth factor binding protein 2)

Gene

• Entrez ID: 83888
• Gene name: Fibroblast growth factor binding protein 2
• Gene symbol: FGFBP2
• Synonyms (NCBI Gene): HBP17RP, KSP37
• Chromosome: 4
• Chromosome location: 4p15.32
• Summary: This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT995889	hsa-miR-3065-3p	CLIP-seq
MIRT995890	hsa-miR-487a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0007267	Process	Cell-cell signaling	IBA
GO:0019838	Function	Growth factor binding	IBA
GO:0019838	Function	Growth factor binding	IEA

Other IDs

• MIM: 607713
• HGNC: 29451
• e!Ensembl: ENSG00000137441

Protein

• UniProt ID: Q9BYJ0
• Protein name: Fibroblast growth factor-binding protein 2 (FGF-BP2) (FGF-binding protein 2) (FGFBP-2) (37 kDa killer-specific secretory protein) (Ksp37) (HBp17-related protein) (HBp17-RP)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06473	FGF-BP1	5 → 223	FGF binding protein 1 (FGF-BP1)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in serum, peripheral leukocytes and cytotoxic T-lymphocytes, but not in granulocytes and monocytes (at protein level). {ECO:0000269|PubMed:11342666}.
• Sequence:

  MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLR
  VDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREA
  GPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
  PTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG

• Sequence length: 223

Pathways

Reactome:

FGFR2b ligand binding and activation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	15270853	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29794786	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38266804, 39363164	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21079801		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40416605	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21079801	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	29794786		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	27032399		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	27670201	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38065972	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21079801		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	30683112	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21079801	Associate	★☆☆☆☆ Found in Text Mining only