TSPAN10 (tetraspanin 10)

Gene

• Entrez ID: 83882
• Gene name: Tetraspanin 10
• Gene symbol: TSPAN10
• Synonyms (NCBI Gene): OCSP
• Chromosome: 17
• Chromosome location: 17q25.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT574049	hsa-miR-6869-3p	PAR-CLIP	20371350
MIRT574048	hsa-miR-3960	PAR-CLIP	20371350
MIRT574047	hsa-miR-8072	PAR-CLIP	20371350
MIRT574046	hsa-miR-4467	PAR-CLIP	20371350
MIRT574048	hsa-miR-3960	PAR-CLIP	26701625
MIRT574046	hsa-miR-4467	PAR-CLIP	26701625
MIRT574049	hsa-miR-6869-3p	PAR-CLIP	26701625
MIRT574047	hsa-miR-8072	PAR-CLIP	26701625
MIRT574049	hsa-miR-6869-3p	PAR-CLIP	20371350
MIRT574048	hsa-miR-3960	PAR-CLIP	20371350
MIRT574047	hsa-miR-8072	PAR-CLIP	20371350
MIRT574046	hsa-miR-4467	PAR-CLIP	20371350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23091066
GO:0072594	Process	Establishment of protein localization to organelle	IDA	23091066

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9H1Z9
• Protein name: Tetraspanin-10 (Tspan-10) (Oculospanin)
• Protein function: Part of TspanC8 subgroup, composed of 6 members that interact with the transmembrane metalloprotease ADAM10. This interaction is required for ADAM10 exit from the endoplasmic reticulum and for enzymatic maturation and trafficking to the cell sur
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00335	Tetraspanin	76 → 318	Tetraspanin family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the eye, including iris, ciliary body, retinal pigment epithelium, but not lens (protein level). {ECO:0000269|PubMed:12107410}.
• Sequence:

  MEEGERSPLLSQETAGQKPLSVHRPPTSGCLGPVPREDQAEAWGCSCCPPETKHQALSGT
  PKKGPAPSLSPGSSCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPTDP
  MLGLALGGLVVSAASLAGCLGALCENTCLLRGFSGGILAFLVLEAVAGALVVALWGPLQD
  SLEHTLRVAIAHYQDDPDLRFLLDQVQLGLRCCGAASYQDWQQNLYFNCSSPGVQACSLP
  ASCCIDPREDGASVNDQCGFGVLRLDADAAQRVVYLEGCGPPLRRWLRANLAASGGYAIA
  VVLLQGAELLLAARLLGALAARSGAAYGPGAHGEDRAGPQSPSPGAPPAAKPARG

• Sequence length: 355

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CORNEAL ASTIGMATISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	30535121, 36951251	Associate	★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	Pubtator	30306274	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33960436	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15001788		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30535121	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30535121	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24727681		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	31995762	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15001788		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	GWASCAT_DG	27182965		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	30306274, 30535121	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30535121	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	30535121	Associate	★☆☆☆☆ Found in Text Mining only
Regular astigmatism - corneal	Corneal astigmatism	BEFREE	30306274		★☆☆☆☆ Found in Text Mining only
Regular astigmatism - corneal	Corneal astigmatism	GWASCAT_DG	30306274		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	30535121	Associate	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	BEFREE	31073882		★☆☆☆☆ Found in Text Mining only
Velopharyngeal Insufficiency	Velopharyngeal Insufficiency	BEFREE	31158572		★☆☆☆☆ Found in Text Mining only