Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	83881
Gene name	Mix paired-like homeobox
Gene symbol	MIXL1
Synonyms (NCBI Gene)	MILD1MIXMIXL
Chromosome	1
Chromosome location	1q42.12
Summary	Homeodomain proteins, such as MIXL1, are transcription factors that regulate cell fate during development (Hart et al., 2005 [PubMed 15982639]).[supplied by OMIM, Mar 2008]

Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021535	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT516562	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT516561	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT516560	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT516559	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT516558	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT516557	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT516556	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT516555	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT516554	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT516553	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT516552	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT516551	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT516550	hsa-miR-302e	PAR-CLIP	23446348
MIRT516549	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT516548	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT516547	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT516546	hsa-miR-520b	PAR-CLIP	23446348
MIRT516545	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT516544	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT516543	hsa-miR-520e	PAR-CLIP	23446348
MIRT516542	hsa-miR-4433b-3p	PAR-CLIP	23446348
MIRT516541	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT516540	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT516539	hsa-miR-520h	PAR-CLIP	23446348
MIRT516538	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT516537	hsa-miR-1273g-3p	PAR-CLIP	23446348
MIRT516536	hsa-miR-186-3p	PAR-CLIP	23446348
MIRT516535	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT516534	hsa-miR-3130-3p	PAR-CLIP	23446348
MIRT516532	hsa-miR-5186	PAR-CLIP	23446348
MIRT516533	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT516531	hsa-miR-873-5p	PAR-CLIP	23446348
MIRT516530	hsa-miR-1286	PAR-CLIP	23446348
MIRT516528	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT516529	hsa-miR-4252	PAR-CLIP	23446348
MIRT516527	hsa-miR-4663	PAR-CLIP	23446348
MIRT516526	hsa-miR-7160-5p	PAR-CLIP	23446348
MIRT516525	hsa-miR-8077	PAR-CLIP	23446348
MIRT516524	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT516523	hsa-miR-500a-3p	PAR-CLIP	23446348
MIRT516522	hsa-miR-6511b-5p	PAR-CLIP	23446348
MIRT516521	hsa-miR-6811-5p	PAR-CLIP	23446348
MIRT516562	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT516561	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT516560	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT516559	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT516558	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT516557	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT516556	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT516555	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT516554	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT516553	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT516552	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT516551	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT516550	hsa-miR-302e	PAR-CLIP	23446348
MIRT516549	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT516548	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT516547	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT516546	hsa-miR-520b	PAR-CLIP	23446348
MIRT516545	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT516544	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT516543	hsa-miR-520e	PAR-CLIP	23446348
MIRT516542	hsa-miR-4433b-3p	PAR-CLIP	23446348
MIRT516541	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT516540	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT516539	hsa-miR-520h	PAR-CLIP	23446348
MIRT516538	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT516537	hsa-miR-1273g-3p	PAR-CLIP	23446348
MIRT516536	hsa-miR-186-3p	PAR-CLIP	23446348
MIRT516535	hsa-miR-150-5p	PAR-CLIP	23446348
MIRT516534	hsa-miR-3130-3p	PAR-CLIP	23446348
MIRT516532	hsa-miR-5186	PAR-CLIP	23446348
MIRT516533	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT516531	hsa-miR-873-5p	PAR-CLIP	23446348
MIRT516530	hsa-miR-1286	PAR-CLIP	23446348
MIRT516528	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT516529	hsa-miR-4252	PAR-CLIP	23446348
MIRT516527	hsa-miR-4663	PAR-CLIP	23446348
MIRT516526	hsa-miR-7160-5p	PAR-CLIP	23446348
MIRT516525	hsa-miR-8077	PAR-CLIP	23446348
MIRT516524	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT516523	hsa-miR-500a-3p	PAR-CLIP	23446348
MIRT516522	hsa-miR-6511b-5p	PAR-CLIP	23446348
MIRT516521	hsa-miR-6811-5p	PAR-CLIP	23446348

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	22164283
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	ISS
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	22164283
GO:0001706	Process	Endoderm formation	IBA
GO:0001706	Process	Endoderm formation	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007369	Process	Gastrulation	IEA
GO:0007369	Process	Gastrulation	ISS
GO:0007492	Process	Endoderm development	IEA
GO:0007492	Process	Endoderm development	IEA
GO:0007492	Process	Endoderm development	ISS
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0030097	Process	Hemopoiesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0035987	Process	Endodermal cell differentiation	IEA
GO:0035987	Process	Endodermal cell differentiation	ISS
GO:0042074	Process	Cell migration involved in gastrulation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS	22164283
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	22164283
GO:0048565	Process	Digestive tract development	IEA
GO:0048565	Process	Digestive tract development	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	22164283
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS	22164283
GO:1901533	Process	Negative regulation of hematopoietic progenitor cell differentiation	IEA
GO:1901533	Process	Negative regulation of hematopoietic progenitor cell differentiation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2000382	Process	Positive regulation of mesoderm development	IEA
GO:2000382	Process	Positive regulation of mesoderm development	ISS

MIM	HGNC	e!Ensembl
609852	13363	ENSG00000185155

Q9H2W2

Protein name

Homeobox protein MIXL1 (Homeodomain protein MIX) (hMix) (MIX1 homeobox-like protein 1) (Mix.1 homeobox-like protein)

Protein function

Transcription factor that play a central role in proper axial mesendoderm morphogenesis and endoderm formation. Required for efficient differentiation of cells from the primitive streak stage to blood, by acting early in the recruitment and/or e

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	87 → 143	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Restricted to progenitors and secondary lymph tissues. In normal hematopoiesis, it is restricted to immature B- and T-lymphoid cells. Present in differentiating embryonic stem cells (at protein level). {ECO:0000269|PubMed:12070013, ECO

Sequence

MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPATFAGFLGRDP
GPAPPPPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLA
ALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVD
VNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF

Sequence length

232

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	17303500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	31567420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bedwetting	Nocturnal enuresis	BEFREE	30900621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28741646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22016793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	17303500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31353575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29163175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29163175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31602779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31602779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17303500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	17303500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	17303500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17303500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25544748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	17303500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	17303500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	28741646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28558366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31353575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34546237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17303500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30857675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37279148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	31347545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	28558366		★★★★★ ★☆☆☆☆ Found in Text Mining only

MIXL1 (Mix paired-like homeobox)