Gene Gene information from NCBI Gene database.
Entrez ID 83876
Gene name Maestro
Gene symbol MRO
Synonyms (NCBI Gene)
B29C18orf3
Chromosome 18
Chromosome location 18q21.2
Summary This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination. Multiple transcript variants encoding different isoforms have been found for th
miRNA miRNA information provided by mirtarbase database.
445
miRTarBase ID miRNA Experiments Reference
MIRT716469 hsa-miR-7109-3p HITS-CLIP 19536157
MIRT716468 hsa-miR-548ag HITS-CLIP 19536157
MIRT716467 hsa-miR-548ai HITS-CLIP 19536157
MIRT716466 hsa-miR-548ba HITS-CLIP 19536157
MIRT716465 hsa-miR-570-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IEA
GO:0005730 Component Nucleolus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608080 24121 ENSG00000134042
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BYG7
Protein name Protein maestro (Male-specific transcription in the developing reproductive organs) (Protein B29)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11401430}.
Sequence
MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSKVSWKLRFQKREPLKNVFFILAERARDP
SAKKRHMAMRNLGTMAYEAPDKVRKYKKIVLDLLVYGLYDPVNLEVIHESMKTLTVVLGK
IQGKGLGSFFIDITLQTRTLLDDENDSLRYSAFVLFGQLAAFAGRKWKKFFTSQVKQTRD
SLLIHLQDRNPQVAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQ
FFYANKIL
Sequence length 248
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anaplastic carcinoma Anaplastic Carcinoma BEFREE 23059472
★☆☆☆☆
Found in Text Mining only
Anaplastic thyroid carcinoma Anaplastic thyroid cancer BEFREE 9177396
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 9177396
★☆☆☆☆
Found in Text Mining only
Chronic Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 10048429
★☆☆☆☆
Found in Text Mining only
Follicular adenoma Adenoma BEFREE 9177396
★☆☆☆☆
Found in Text Mining only
Follicular thyroid carcinoma Follicular Thyroid Carcinoma BEFREE 23059472
★☆☆☆☆
Found in Text Mining only
Hematopoietic Neoplasms Hematopoietic Neoplasms BEFREE 8255092
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma CTD_human_DG 28284560
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung Neoplasms BEFREE 30286184
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of thyroid Thyroid cancer BEFREE 8519090
★☆☆☆☆
Found in Text Mining only