TAS1R3 (taste 1 receptor member 3)

Gene

• Entrez ID: 83756
• Gene name: Taste 1 receptor member 3
• Gene symbol: TAS1R3
• Synonyms (NCBI Gene): T1R3
• Chromosome: 1
• Chromosome location: 1p36.33
• Summary: The protein encoded by this gene is a G-protein coupled receptor involved in taste responses. The encoded protein can form a heterodimeric receptor with TAS1R1 to elicit the umami taste response, or it can bind with TAS1R2 to form a receptor for the sweet

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001582	Process	Detection of chemical stimulus involved in sensory perception of sweet taste	IDA	16720576
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IC	16720576
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008527	Function	Taste receptor activity	IDA	16720576
GO:0008527	Function	Taste receptor activity	IEA
GO:0008527	Function	Taste receptor activity	IPI	11917125
GO:0016020	Component	Membrane	IC	11917125
GO:0016020	Component	Membrane	IEA
GO:0033041	Function	Sweet taste receptor activity	IBA
GO:0033041	Function	Sweet taste receptor activity	IDA	16720576
GO:0050909	Process	Sensory perception of taste	IEA
GO:0050916	Process	Sensory perception of sweet taste	IBA
GO:0050916	Process	Sensory perception of sweet taste	IDA	11917125, 12892531, 15299024
GO:0050916	Process	Sensory perception of sweet taste	IEA
GO:0050916	Process	Sensory perception of sweet taste	IEA
GO:0050917	Process	Sensory perception of umami taste	IBA
GO:0050917	Process	Sensory perception of umami taste	IDA	11917125
GO:0050917	Process	Sensory perception of umami taste	IEA
GO:1903767	Component	Sweet taste receptor complex	IDA	16720576

Other IDs

• MIM: 605865
• HGNC: 15661
• e!Ensembl: ENSG00000169962

Protein

• UniProt ID: Q7RTX0
• Protein name: Taste receptor type 1 member 3 (Sweet taste receptor T1R3)
• Protein function: Putative taste receptor. TAS1R1/TAS1R3 responds to the umami taste stimulus (the taste of monosodium glutamate). TAS1R2/TAS1R3 recognizes diverse natural and synthetic sweeteners. TAS1R3 is essential for the recognition and response to the disac
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01094	ANF_receptor	71 → 464	Receptor family ligand binding region	Family
  PF07562	NCD3G	495 → 547	Nine Cysteines Domain of family 3 GPCR	Family
  PF00003	7tm_3	570 → 816	7 transmembrane sweet-taste receptor of 3 GCPR	Family

• Sequence:

  MLGPAVLGLSLWALLHPGTGAPLCLSQQLRMKGDYVLGGLFPLGEAEEAGLRSRTRPSSP
  VCTRFSSNGLLWALAMKMAVEEINNKSDLLPGLRLGYDLFDTCSEPVVAMKPSLMFLAKA
  GSRDIAAYCNYTQYQPRVLAVIGPHSSELAMVTGKFFSFFLMPQVSYGASMELLSARETF
  PSFFRTVPSDRVQLTAAAELLQEFGWNWVAALGSDDEYGRQGLSIFSALAAARGICIAHE
  GLVPLPRADDSRLGKVQDVLHQVNQSSVQVVLLFASVHAAHALFNYSISSRLSPKVWVAS
  EAWLTSDLVMGLPGMAQMGTVLGFLQRGAQLHEFPQYVKTHLALATDPAFCSALGEREQG
  LEEDVVGQRCPQCDCITLQNVSAGLNHHQTFSVYAAVYSVAQALHNTLQCNASGCPAQDP
  VKPWQLLENMYNLTFHVGGLPLRFDSSGNVDMEYDLKLWVWQGSVPRLHDVGRFNGSLRT
  ERLKIRWHTSDNQKPVSRCSRQCQEGQVRRVKGFHSCCYDCVDCEAGSYRQNPDDIACTF
  CGQDEWSPERSTRCFRRRSRFLAWGEPAVLLLLLLLSLALGLVLAALGLFVHHRDSPLVQ
  ASGGPLACFGLVCLGLVCLSVLLFPGQPSPARCLAQQPLSHLPLTGCLSTLFLQAAEIFV
  ESELPLSWADRLSGCLRGPWAWLVVLLAMLVEVALCTWYLVAFPPEVVTDWHMLPTEALV
  HCRTRSWVSFGLAHATNATLAFLCFLGTFLVRSQPGCYNRARGLTFAMLAYFITWVSFVP
  LLANVQVVLRPAVQMGALLLCVLGILAAFHLPRCYLLMRQPGLNTPEFFLGGGPGDAQGQ
  NDGNTGNQGKHE

• Sequence length: 852

Pathways

KEGG:

Taste transduction
Carbohydrate digestion and absorption

Reactome:

G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
INFERTILITY, MALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	38375886	Associate	★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	17928076		★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	30353220	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20660058, 35466133, 37164729	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23761104	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19039089		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30353220		★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	30022304		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35466133	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29874909		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20660058	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22083550	Inhibit	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28971978		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	22083550	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	26422579		★☆☆☆☆ Found in Text Mining only
Taste Disorders	Taste Disorders	BEFREE	25990784		★☆☆☆☆ Found in Text Mining only