Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	83729
Gene name	Inhibin subunit beta E
Gene symbol	INHBE
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12q13.3
Summary	This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate an inhibin beta subunit. Inhibins have been implicated in regulating numerous cellular

124

Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016770	hsa-miR-335-5p	Microarray	18185580
MIRT027405	hsa-miR-98-5p	Microarray	19088304
MIRT739666	hsa-miR-1470	CLIP-seq
MIRT1066651	hsa-miR-1827	CLIP-seq
MIRT1066652	hsa-miR-3148	CLIP-seq
MIRT1066653	hsa-miR-3153	CLIP-seq
MIRT1066654	hsa-miR-3178	CLIP-seq
MIRT1066655	hsa-miR-331-3p	CLIP-seq
MIRT1066656	hsa-miR-335	CLIP-seq
MIRT1066657	hsa-miR-3647-3p	CLIP-seq
MIRT1066658	hsa-miR-3672	CLIP-seq
MIRT1066659	hsa-miR-3926	CLIP-seq
MIRT1066660	hsa-miR-3929	CLIP-seq
MIRT1066661	hsa-miR-423-3p	CLIP-seq
MIRT1066662	hsa-miR-4292	CLIP-seq
MIRT739670	hsa-miR-4297	CLIP-seq
MIRT1066663	hsa-miR-4299	CLIP-seq
MIRT1066664	hsa-miR-4419b	CLIP-seq
MIRT1066665	hsa-miR-4421	CLIP-seq
MIRT1066666	hsa-miR-4461	CLIP-seq
MIRT739667	hsa-miR-4469	CLIP-seq
MIRT1066667	hsa-miR-4478	CLIP-seq
MIRT1066668	hsa-miR-4646-5p	CLIP-seq
MIRT1066669	hsa-miR-4649-3p	CLIP-seq
MIRT739665	hsa-miR-4667-3p	CLIP-seq
MIRT1066670	hsa-miR-4668-5p	CLIP-seq
MIRT739668	hsa-miR-4768-5p	CLIP-seq
MIRT1066671	hsa-miR-4775	CLIP-seq
MIRT1066672	hsa-miR-4786-5p	CLIP-seq
MIRT1066673	hsa-miR-4793-5p	CLIP-seq
MIRT1066674	hsa-miR-4795-3p	CLIP-seq
MIRT1066675	hsa-miR-485-5p	CLIP-seq
MIRT1066676	hsa-miR-508-5p	CLIP-seq
MIRT1066677	hsa-miR-542-3p	CLIP-seq
MIRT1066678	hsa-miR-548aa	CLIP-seq
MIRT1066679	hsa-miR-548ac	CLIP-seq
MIRT1066680	hsa-miR-548d-3p	CLIP-seq
MIRT1066681	hsa-miR-548s	CLIP-seq
MIRT1066682	hsa-miR-548z	CLIP-seq
MIRT1066683	hsa-miR-566	CLIP-seq
MIRT1066684	hsa-miR-590-3p	CLIP-seq
MIRT739669	hsa-miR-642a	CLIP-seq
MIRT1066685	hsa-miR-653	CLIP-seq
MIRT1066686	hsa-miR-766	CLIP-seq
MIRT1066687	hsa-miR-769-5p	CLIP-seq
MIRT2015990	hsa-miR-187	CLIP-seq
MIRT2015991	hsa-miR-298	CLIP-seq
MIRT1066653	hsa-miR-3153	CLIP-seq
MIRT2015992	hsa-miR-34b	CLIP-seq
MIRT2015993	hsa-miR-3614-5p	CLIP-seq
MIRT1066660	hsa-miR-3929	CLIP-seq
MIRT1066661	hsa-miR-423-3p	CLIP-seq
MIRT1066664	hsa-miR-4419b	CLIP-seq
MIRT1066667	hsa-miR-4478	CLIP-seq
MIRT1066668	hsa-miR-4646-5p	CLIP-seq
MIRT1066670	hsa-miR-4668-5p	CLIP-seq
MIRT2015994	hsa-miR-4768-3p	CLIP-seq
MIRT1066675	hsa-miR-485-5p	CLIP-seq
MIRT2015995	hsa-miR-597	CLIP-seq
MIRT2015996	hsa-miR-665	CLIP-seq
MIRT2248467	hsa-miR-106a	CLIP-seq
MIRT2248468	hsa-miR-106b	CLIP-seq
MIRT2248469	hsa-miR-1324	CLIP-seq
MIRT2248470	hsa-miR-17	CLIP-seq
MIRT1066651	hsa-miR-1827	CLIP-seq
MIRT2248471	hsa-miR-20a	CLIP-seq
MIRT2248472	hsa-miR-20b	CLIP-seq
MIRT2248473	hsa-miR-24	CLIP-seq
MIRT2015991	hsa-miR-298	CLIP-seq
MIRT1066654	hsa-miR-3178	CLIP-seq
MIRT2015992	hsa-miR-34b	CLIP-seq
MIRT2015993	hsa-miR-3614-5p	CLIP-seq
MIRT2248474	hsa-miR-371b-3p	CLIP-seq
MIRT1066660	hsa-miR-3929	CLIP-seq
MIRT2248475	hsa-miR-4284	CLIP-seq
MIRT2248476	hsa-miR-4330	CLIP-seq
MIRT1066664	hsa-miR-4419b	CLIP-seq
MIRT1066667	hsa-miR-4478	CLIP-seq
MIRT2248477	hsa-miR-4641	CLIP-seq
MIRT1066669	hsa-miR-4649-3p	CLIP-seq
MIRT2248478	hsa-miR-4755-3p	CLIP-seq
MIRT2015994	hsa-miR-4768-3p	CLIP-seq
MIRT1066675	hsa-miR-485-5p	CLIP-seq
MIRT2248479	hsa-miR-519d	CLIP-seq
MIRT2248480	hsa-miR-548l	CLIP-seq
MIRT1066683	hsa-miR-566	CLIP-seq
MIRT2015996	hsa-miR-665	CLIP-seq
MIRT2248481	hsa-miR-93	CLIP-seq
MIRT2451865	hsa-miR-2115	CLIP-seq
MIRT2451866	hsa-miR-4686	CLIP-seq
MIRT2451867	hsa-miR-4691-5p	CLIP-seq
MIRT2451868	hsa-miR-516a-3p	CLIP-seq
MIRT1066651	hsa-miR-1827	CLIP-seq
MIRT2015991	hsa-miR-298	CLIP-seq
MIRT2552003	hsa-miR-3150a-5p	CLIP-seq
MIRT2552004	hsa-miR-3150b-5p	CLIP-seq
MIRT1066654	hsa-miR-3178	CLIP-seq
MIRT1066659	hsa-miR-3926	CLIP-seq
MIRT1066660	hsa-miR-3929	CLIP-seq
MIRT1066661	hsa-miR-423-3p	CLIP-seq
MIRT1066664	hsa-miR-4419b	CLIP-seq
MIRT2552005	hsa-miR-4460	CLIP-seq
MIRT1066667	hsa-miR-4478	CLIP-seq
MIRT1066669	hsa-miR-4649-3p	CLIP-seq
MIRT2552006	hsa-miR-4727-3p	CLIP-seq
MIRT1066672	hsa-miR-4786-5p	CLIP-seq
MIRT1066673	hsa-miR-4793-5p	CLIP-seq
MIRT1066675	hsa-miR-485-5p	CLIP-seq
MIRT1066681	hsa-miR-548s	CLIP-seq
MIRT1066683	hsa-miR-566	CLIP-seq
MIRT1066685	hsa-miR-653	CLIP-seq
MIRT1066687	hsa-miR-769-5p	CLIP-seq
MIRT1066651	hsa-miR-1827	CLIP-seq
MIRT2552003	hsa-miR-3150a-5p	CLIP-seq
MIRT2552004	hsa-miR-3150b-5p	CLIP-seq
MIRT1066654	hsa-miR-3178	CLIP-seq
MIRT1066660	hsa-miR-3929	CLIP-seq
MIRT1066661	hsa-miR-423-3p	CLIP-seq
MIRT1066664	hsa-miR-4419b	CLIP-seq
MIRT1066667	hsa-miR-4478	CLIP-seq
MIRT1066669	hsa-miR-4649-3p	CLIP-seq
MIRT2552006	hsa-miR-4727-3p	CLIP-seq
MIRT1066675	hsa-miR-485-5p	CLIP-seq
MIRT1066683	hsa-miR-566	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	ISS
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	ISS
GO:0007178	Process	Cell surface receptor protein serine/threonine kinase signaling pathway	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0032924	Process	Activin receptor signaling pathway	IMP	15150278
GO:1904178	Process	Negative regulation of adipose tissue development	IEA
GO:1904178	Process	Negative regulation of adipose tissue development	ISS

MIM	HGNC	e!Ensembl
612031	24029	ENSG00000139269

P58166

Protein name

Inhibin beta E chain (Activin beta-E chain)

Protein function

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonad

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00019	TGF_beta	246 → 349	Transforming growth factor beta like domain	Domain

Sequence

MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSR
PRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHH
LYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRG
EKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTC
EPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFS
LLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Sequence length

350

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction TGF-beta signaling pathway Signaling pathways regulating pluripotency of stem cells		Glycoprotein hormones

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPIDOSES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOIDOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (46)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Angina Unstable	Angina pectoris	Pubtator	15261933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	17258738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19733294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10559140, 20954112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	26447543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	7670558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11278744, 30343527, 37870468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	32970737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26449823, 28418896, 38030164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	9365168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31375600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	10780520, 12366660, 24302632, 39248018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33761648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37845228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17258738, 20011542, 22761777, 28418896, 28717230, 36591565, 9482899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25374171	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25833251, 35999217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34391409, 35999217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29596463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26384307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21496809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	16033091, 17649811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	26384307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	20954112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	35999217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoidosis	Lipoidosis	CTD_human_DG	17175557		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	26238393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15064726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	25557874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34391409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	35896531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22685544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26238393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	36300658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	7599706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10638976, 23967299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	37963137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	24781282	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34741430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38030164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16718778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34481843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	27833918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

INHBE (inhibin subunit beta E)