Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	83666
Gene name	Poly(ADP-ribose) polymerase family member 9
Gene symbol	PARP9
Synonyms (NCBI Gene)	ARTD9BALBAL1MGC:7868
Chromosome	3
Chromosome location	3q21.1

439

Show/Hide all (439)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022841	hsa-miR-124-3p	Microarray	18668037
MIRT030872	hsa-miR-21-5p	Microarray	18591254
MIRT1214658	hsa-miR-1299	CLIP-seq
MIRT1214659	hsa-miR-3148	CLIP-seq
MIRT1214660	hsa-miR-326	CLIP-seq
MIRT1214661	hsa-miR-330-5p	CLIP-seq
MIRT1214662	hsa-miR-4668-3p	CLIP-seq
MIRT1214663	hsa-miR-875-3p	CLIP-seq
MIRT1214664	hsa-miR-1227	CLIP-seq
MIRT1214665	hsa-miR-1285	CLIP-seq
MIRT1214666	hsa-miR-1293	CLIP-seq
MIRT1214667	hsa-miR-146a	CLIP-seq
MIRT1214668	hsa-miR-146b-5p	CLIP-seq
MIRT1214669	hsa-miR-2467-3p	CLIP-seq
MIRT1214670	hsa-miR-3122	CLIP-seq
MIRT1214671	hsa-miR-3187-5p	CLIP-seq
MIRT1214672	hsa-miR-3622b-5p	CLIP-seq
MIRT1214673	hsa-miR-3673	CLIP-seq
MIRT1214674	hsa-miR-3678-3p	CLIP-seq
MIRT1214675	hsa-miR-3689a-3p	CLIP-seq
MIRT1214676	hsa-miR-3689c	CLIP-seq
MIRT1214677	hsa-miR-370	CLIP-seq
MIRT1214678	hsa-miR-3913-5p	CLIP-seq
MIRT1214679	hsa-miR-3917	CLIP-seq
MIRT1214680	hsa-miR-3919	CLIP-seq
MIRT1214681	hsa-miR-3945	CLIP-seq
MIRT1214682	hsa-miR-4252	CLIP-seq
MIRT1214683	hsa-miR-4253	CLIP-seq
MIRT1214684	hsa-miR-4293	CLIP-seq
MIRT1214685	hsa-miR-4317	CLIP-seq
MIRT1214686	hsa-miR-4328	CLIP-seq
MIRT1214687	hsa-miR-4426	CLIP-seq
MIRT1214688	hsa-miR-4446-5p	CLIP-seq
MIRT1214689	hsa-miR-4450	CLIP-seq
MIRT1214690	hsa-miR-4483	CLIP-seq
MIRT1214691	hsa-miR-4647	CLIP-seq
MIRT1214692	hsa-miR-4662b	CLIP-seq
MIRT1214693	hsa-miR-4693-3p	CLIP-seq
MIRT1214694	hsa-miR-4727-3p	CLIP-seq
MIRT1214695	hsa-miR-4728-5p	CLIP-seq
MIRT1214696	hsa-miR-4731-5p	CLIP-seq
MIRT1214697	hsa-miR-4763-5p	CLIP-seq
MIRT1214698	hsa-miR-4765	CLIP-seq
MIRT1214699	hsa-miR-4793-3p	CLIP-seq
MIRT1214700	hsa-miR-491-5p	CLIP-seq
MIRT1214701	hsa-miR-508-5p	CLIP-seq
MIRT1214702	hsa-miR-542-3p	CLIP-seq
MIRT1214703	hsa-miR-545	CLIP-seq
MIRT1214704	hsa-miR-548a-5p	CLIP-seq
MIRT1214705	hsa-miR-548ab	CLIP-seq
MIRT1214706	hsa-miR-548ak	CLIP-seq
MIRT1214707	hsa-miR-548b-5p	CLIP-seq
MIRT1214708	hsa-miR-548c-5p	CLIP-seq
MIRT1214709	hsa-miR-548d-5p	CLIP-seq
MIRT1214710	hsa-miR-548h	CLIP-seq
MIRT1214711	hsa-miR-548i	CLIP-seq
MIRT1214712	hsa-miR-548j	CLIP-seq
MIRT1214713	hsa-miR-548w	CLIP-seq
MIRT1214714	hsa-miR-548y	CLIP-seq
MIRT1214715	hsa-miR-559	CLIP-seq
MIRT1214716	hsa-miR-562	CLIP-seq
MIRT1214717	hsa-miR-612	CLIP-seq
MIRT1214718	hsa-miR-619	CLIP-seq
MIRT1214719	hsa-miR-658	CLIP-seq
MIRT1214720	hsa-miR-766	CLIP-seq
MIRT1214721	hsa-miR-124	CLIP-seq
MIRT1214722	hsa-miR-299-3p	CLIP-seq
MIRT1214723	hsa-miR-3146	CLIP-seq
MIRT1214724	hsa-miR-3617	CLIP-seq
MIRT1214687	hsa-miR-4426	CLIP-seq
MIRT1214725	hsa-miR-4474-3p	CLIP-seq
MIRT1214726	hsa-miR-4484	CLIP-seq
MIRT1214727	hsa-miR-4491	CLIP-seq
MIRT1214728	hsa-miR-4540	CLIP-seq
MIRT1214691	hsa-miR-4647	CLIP-seq
MIRT1214729	hsa-miR-4657	CLIP-seq
MIRT1214692	hsa-miR-4662b	CLIP-seq
MIRT1214730	hsa-miR-506	CLIP-seq
MIRT1214731	hsa-miR-548an	CLIP-seq
MIRT1214732	hsa-miR-548u	CLIP-seq
MIRT1214733	hsa-miR-554	CLIP-seq
MIRT1214734	hsa-miR-577	CLIP-seq
MIRT1214735	hsa-miR-641	CLIP-seq
MIRT1214723	hsa-miR-3146	CLIP-seq
MIRT1214687	hsa-miR-4426	CLIP-seq
MIRT1214691	hsa-miR-4647	CLIP-seq
MIRT1214692	hsa-miR-4662b	CLIP-seq
MIRT2061805	hsa-miR-2117	CLIP-seq
MIRT2061806	hsa-miR-3622a-3p	CLIP-seq
MIRT2061807	hsa-miR-3622b-3p	CLIP-seq
MIRT2061808	hsa-miR-3674	CLIP-seq
MIRT2061809	hsa-miR-4453	CLIP-seq
MIRT2061810	hsa-miR-4538	CLIP-seq
MIRT2061811	hsa-miR-4722-5p	CLIP-seq
MIRT2061812	hsa-miR-4768-5p	CLIP-seq
MIRT2061813	hsa-miR-579	CLIP-seq
MIRT2061814	hsa-miR-664	CLIP-seq
MIRT2588280	hsa-let-7a	CLIP-seq
MIRT2588281	hsa-let-7b	CLIP-seq
MIRT2588282	hsa-let-7c	CLIP-seq
MIRT2588283	hsa-let-7d	CLIP-seq
MIRT2588284	hsa-let-7e	CLIP-seq
MIRT2588285	hsa-let-7f	CLIP-seq
MIRT2588286	hsa-let-7g	CLIP-seq
MIRT2588287	hsa-let-7i	CLIP-seq
MIRT2588288	hsa-miR-1205	CLIP-seq
MIRT2588289	hsa-miR-1224-5p	CLIP-seq
MIRT2588290	hsa-miR-1246	CLIP-seq
MIRT2588291	hsa-miR-1255a	CLIP-seq
MIRT2588292	hsa-miR-1255b	CLIP-seq
MIRT2588293	hsa-miR-125a-3p	CLIP-seq
MIRT2588294	hsa-miR-1262	CLIP-seq
MIRT2588295	hsa-miR-1276	CLIP-seq
MIRT2588296	hsa-miR-1304	CLIP-seq
MIRT2588297	hsa-miR-1321	CLIP-seq
MIRT2588298	hsa-miR-1324	CLIP-seq
MIRT1214667	hsa-miR-146a	CLIP-seq
MIRT1214668	hsa-miR-146b-5p	CLIP-seq
MIRT2588299	hsa-miR-1827	CLIP-seq
MIRT2588300	hsa-miR-185	CLIP-seq
MIRT2588301	hsa-miR-202	CLIP-seq
MIRT2588302	hsa-miR-2114	CLIP-seq
MIRT2588303	hsa-miR-219-1-3p	CLIP-seq
MIRT2588304	hsa-miR-221	CLIP-seq
MIRT2588305	hsa-miR-222	CLIP-seq
MIRT2588306	hsa-miR-2278	CLIP-seq
MIRT1214669	hsa-miR-2467-3p	CLIP-seq
MIRT2588307	hsa-miR-25	CLIP-seq
MIRT2588308	hsa-miR-2909	CLIP-seq
MIRT2588309	hsa-miR-3065-5p	CLIP-seq
MIRT2588310	hsa-miR-30a	CLIP-seq
MIRT2588311	hsa-miR-30b	CLIP-seq
MIRT2588312	hsa-miR-30c	CLIP-seq
MIRT2588313	hsa-miR-30d	CLIP-seq
MIRT2588314	hsa-miR-30e	CLIP-seq
MIRT2588315	hsa-miR-3135b	CLIP-seq
MIRT2588316	hsa-miR-3140-3p	CLIP-seq
MIRT2588317	hsa-miR-3145-5p	CLIP-seq
MIRT2588318	hsa-miR-3150a-5p	CLIP-seq
MIRT2588319	hsa-miR-3150b-3p	CLIP-seq
MIRT2588320	hsa-miR-3150b-5p	CLIP-seq
MIRT2588321	hsa-miR-3160-3p	CLIP-seq
MIRT2588322	hsa-miR-3162-5p	CLIP-seq
MIRT2588323	hsa-miR-3166	CLIP-seq
MIRT2588324	hsa-miR-3176	CLIP-seq
MIRT2588325	hsa-miR-3177-3p	CLIP-seq
MIRT2588326	hsa-miR-3192	CLIP-seq
MIRT2588327	hsa-miR-32	CLIP-seq
MIRT1214660	hsa-miR-326	CLIP-seq
MIRT1214661	hsa-miR-330-5p	CLIP-seq
MIRT2588328	hsa-miR-335	CLIP-seq
MIRT2588329	hsa-miR-337-3p	CLIP-seq
MIRT2588330	hsa-miR-345	CLIP-seq
MIRT2061806	hsa-miR-3622a-3p	CLIP-seq
MIRT2061807	hsa-miR-3622b-3p	CLIP-seq
MIRT2588331	hsa-miR-363	CLIP-seq
MIRT2588332	hsa-miR-3652	CLIP-seq
MIRT2588333	hsa-miR-3662	CLIP-seq
MIRT2588334	hsa-miR-3665	CLIP-seq
MIRT2588335	hsa-miR-3667-5p	CLIP-seq
MIRT2588336	hsa-miR-367	CLIP-seq
MIRT1214673	hsa-miR-3673	CLIP-seq
MIRT2588337	hsa-miR-3688-5p	CLIP-seq
MIRT1214675	hsa-miR-3689a-3p	CLIP-seq
MIRT1214676	hsa-miR-3689c	CLIP-seq
MIRT2588338	hsa-miR-376c	CLIP-seq
MIRT2588339	hsa-miR-3915	CLIP-seq
MIRT2588340	hsa-miR-3922-3p	CLIP-seq
MIRT2588341	hsa-miR-3925-5p	CLIP-seq
MIRT2588342	hsa-miR-3928	CLIP-seq
MIRT2588343	hsa-miR-3929	CLIP-seq
MIRT2588344	hsa-miR-3941	CLIP-seq
MIRT2588345	hsa-miR-4267	CLIP-seq
MIRT2588346	hsa-miR-4299	CLIP-seq
MIRT2588347	hsa-miR-4300	CLIP-seq
MIRT2588348	hsa-miR-4306	CLIP-seq
MIRT2588349	hsa-miR-4307	CLIP-seq
MIRT2588350	hsa-miR-4311	CLIP-seq
MIRT2588351	hsa-miR-4330	CLIP-seq
MIRT2588352	hsa-miR-4419b	CLIP-seq
MIRT2588353	hsa-miR-4424	CLIP-seq
MIRT2588354	hsa-miR-4430	CLIP-seq
MIRT2588355	hsa-miR-4432	CLIP-seq
MIRT2588356	hsa-miR-4433	CLIP-seq
MIRT2588357	hsa-miR-4434	CLIP-seq
MIRT2588358	hsa-miR-4456	CLIP-seq
MIRT2588359	hsa-miR-4458	CLIP-seq
MIRT2588360	hsa-miR-4459	CLIP-seq
MIRT2588361	hsa-miR-4468	CLIP-seq
MIRT2588362	hsa-miR-4471	CLIP-seq
MIRT2588363	hsa-miR-4478	CLIP-seq
MIRT2588364	hsa-miR-4481	CLIP-seq
MIRT2588365	hsa-miR-4487	CLIP-seq
MIRT2588366	hsa-miR-4495	CLIP-seq
MIRT2588367	hsa-miR-4500	CLIP-seq
MIRT2588368	hsa-miR-4505	CLIP-seq
MIRT2588369	hsa-miR-4516	CLIP-seq
MIRT2588370	hsa-miR-451b	CLIP-seq
MIRT2588371	hsa-miR-4522	CLIP-seq
MIRT2588372	hsa-miR-4531	CLIP-seq
MIRT2588373	hsa-miR-4539	CLIP-seq
MIRT2588374	hsa-miR-4643	CLIP-seq
MIRT2588375	hsa-miR-4644	CLIP-seq
MIRT2588376	hsa-miR-4649-3p	CLIP-seq
MIRT2588377	hsa-miR-4653-3p	CLIP-seq
MIRT2588378	hsa-miR-466	CLIP-seq
MIRT2588379	hsa-miR-4672	CLIP-seq
MIRT2588380	hsa-miR-4680-5p	CLIP-seq
MIRT2588381	hsa-miR-4684-5p	CLIP-seq
MIRT2588382	hsa-miR-4689	CLIP-seq
MIRT1214693	hsa-miR-4693-3p	CLIP-seq
MIRT2588383	hsa-miR-4696	CLIP-seq
MIRT2588384	hsa-miR-4700-3p	CLIP-seq
MIRT2588385	hsa-miR-4701-3p	CLIP-seq
MIRT2588386	hsa-miR-4709-3p	CLIP-seq
MIRT2588387	hsa-miR-4710	CLIP-seq
MIRT2588388	hsa-miR-4711-5p	CLIP-seq
MIRT2588389	hsa-miR-4725-5p	CLIP-seq
MIRT1214694	hsa-miR-4727-3p	CLIP-seq
MIRT1214695	hsa-miR-4728-5p	CLIP-seq
MIRT2588390	hsa-miR-4739	CLIP-seq
MIRT2588391	hsa-miR-4745-5p	CLIP-seq
MIRT2588392	hsa-miR-4751	CLIP-seq
MIRT2588393	hsa-miR-4756-5p	CLIP-seq
MIRT2588394	hsa-miR-4758-5p	CLIP-seq
MIRT2588395	hsa-miR-4766-5p	CLIP-seq
MIRT2588396	hsa-miR-4768-3p	CLIP-seq
MIRT2588397	hsa-miR-4781-3p	CLIP-seq
MIRT2588398	hsa-miR-4784	CLIP-seq
MIRT2588399	hsa-miR-4789-3p	CLIP-seq
MIRT2588400	hsa-miR-485-5p	CLIP-seq
MIRT2588401	hsa-miR-488	CLIP-seq
MIRT2588402	hsa-miR-504	CLIP-seq
MIRT1214701	hsa-miR-508-5p	CLIP-seq
MIRT2588403	hsa-miR-516b	CLIP-seq
MIRT2588404	hsa-miR-526b	CLIP-seq
MIRT2588405	hsa-miR-541	CLIP-seq
MIRT1214703	hsa-miR-545	CLIP-seq
MIRT1214704	hsa-miR-548a-5p	CLIP-seq
MIRT1214705	hsa-miR-548ab	CLIP-seq
MIRT1214706	hsa-miR-548ak	CLIP-seq
MIRT1214707	hsa-miR-548b-5p	CLIP-seq
MIRT1214708	hsa-miR-548c-5p	CLIP-seq
MIRT1214709	hsa-miR-548d-5p	CLIP-seq
MIRT1214710	hsa-miR-548h	CLIP-seq
MIRT1214711	hsa-miR-548i	CLIP-seq
MIRT1214712	hsa-miR-548j	CLIP-seq
MIRT2588406	hsa-miR-548q	CLIP-seq
MIRT2588407	hsa-miR-548v	CLIP-seq
MIRT1214713	hsa-miR-548w	CLIP-seq
MIRT1214714	hsa-miR-548y	CLIP-seq
MIRT2588408	hsa-miR-558	CLIP-seq
MIRT1214715	hsa-miR-559	CLIP-seq
MIRT2588409	hsa-miR-569	CLIP-seq
MIRT1214734	hsa-miR-577	CLIP-seq
MIRT2588410	hsa-miR-583	CLIP-seq
MIRT2588411	hsa-miR-593	CLIP-seq
MIRT2588412	hsa-miR-604	CLIP-seq
MIRT2588413	hsa-miR-618	CLIP-seq
MIRT1214718	hsa-miR-619	CLIP-seq
MIRT2588414	hsa-miR-647	CLIP-seq
MIRT2588415	hsa-miR-653	CLIP-seq
MIRT2588416	hsa-miR-654-5p	CLIP-seq
MIRT2588417	hsa-miR-657	CLIP-seq
MIRT2588418	hsa-miR-920	CLIP-seq
MIRT2588419	hsa-miR-92a	CLIP-seq
MIRT2588420	hsa-miR-92b	CLIP-seq
MIRT2588421	hsa-miR-940	CLIP-seq
MIRT2588422	hsa-miR-98	CLIP-seq
MIRT2588280	hsa-let-7a	CLIP-seq
MIRT2588281	hsa-let-7b	CLIP-seq
MIRT2588282	hsa-let-7c	CLIP-seq
MIRT2588283	hsa-let-7d	CLIP-seq
MIRT2588284	hsa-let-7e	CLIP-seq
MIRT2588285	hsa-let-7f	CLIP-seq
MIRT2588286	hsa-let-7g	CLIP-seq
MIRT2588287	hsa-let-7i	CLIP-seq
MIRT2588288	hsa-miR-1205	CLIP-seq
MIRT2588289	hsa-miR-1224-5p	CLIP-seq
MIRT2588290	hsa-miR-1246	CLIP-seq
MIRT2687179	hsa-miR-1252	CLIP-seq
MIRT2588291	hsa-miR-1255a	CLIP-seq
MIRT2588292	hsa-miR-1255b	CLIP-seq
MIRT2588293	hsa-miR-125a-3p	CLIP-seq
MIRT2687180	hsa-miR-1292	CLIP-seq
MIRT2588296	hsa-miR-1304	CLIP-seq
MIRT2588297	hsa-miR-1321	CLIP-seq
MIRT2588298	hsa-miR-1324	CLIP-seq
MIRT1214667	hsa-miR-146a	CLIP-seq
MIRT1214668	hsa-miR-146b-5p	CLIP-seq
MIRT2588299	hsa-miR-1827	CLIP-seq
MIRT2588300	hsa-miR-185	CLIP-seq
MIRT2588301	hsa-miR-202	CLIP-seq
MIRT2588302	hsa-miR-2114	CLIP-seq
MIRT2588303	hsa-miR-219-1-3p	CLIP-seq
MIRT2588304	hsa-miR-221	CLIP-seq
MIRT2588305	hsa-miR-222	CLIP-seq
MIRT2588306	hsa-miR-2278	CLIP-seq
MIRT1214669	hsa-miR-2467-3p	CLIP-seq
MIRT2588307	hsa-miR-25	CLIP-seq
MIRT2588308	hsa-miR-2909	CLIP-seq
MIRT2588309	hsa-miR-3065-5p	CLIP-seq
MIRT2588310	hsa-miR-30a	CLIP-seq
MIRT2588311	hsa-miR-30b	CLIP-seq
MIRT2588312	hsa-miR-30c	CLIP-seq
MIRT2588313	hsa-miR-30d	CLIP-seq
MIRT2588314	hsa-miR-30e	CLIP-seq
MIRT2588315	hsa-miR-3135b	CLIP-seq
MIRT2588318	hsa-miR-3150a-5p	CLIP-seq
MIRT2588319	hsa-miR-3150b-3p	CLIP-seq
MIRT2588320	hsa-miR-3150b-5p	CLIP-seq
MIRT2588322	hsa-miR-3162-5p	CLIP-seq
MIRT2588323	hsa-miR-3166	CLIP-seq
MIRT2588324	hsa-miR-3176	CLIP-seq
MIRT2588325	hsa-miR-3177-3p	CLIP-seq
MIRT2588326	hsa-miR-3192	CLIP-seq
MIRT2588327	hsa-miR-32	CLIP-seq
MIRT1214660	hsa-miR-326	CLIP-seq
MIRT1214661	hsa-miR-330-5p	CLIP-seq
MIRT2588328	hsa-miR-335	CLIP-seq
MIRT2588329	hsa-miR-337-3p	CLIP-seq
MIRT2588330	hsa-miR-345	CLIP-seq
MIRT2687181	hsa-miR-3605-5p	CLIP-seq
MIRT2061806	hsa-miR-3622a-3p	CLIP-seq
MIRT2061807	hsa-miR-3622b-3p	CLIP-seq
MIRT2588331	hsa-miR-363	CLIP-seq
MIRT2588332	hsa-miR-3652	CLIP-seq
MIRT2588333	hsa-miR-3662	CLIP-seq
MIRT2588334	hsa-miR-3665	CLIP-seq
MIRT2588335	hsa-miR-3667-5p	CLIP-seq
MIRT2588336	hsa-miR-367	CLIP-seq
MIRT1214673	hsa-miR-3673	CLIP-seq
MIRT2588337	hsa-miR-3688-5p	CLIP-seq
MIRT1214675	hsa-miR-3689a-3p	CLIP-seq
MIRT1214676	hsa-miR-3689c	CLIP-seq
MIRT2588338	hsa-miR-376c	CLIP-seq
MIRT2588339	hsa-miR-3915	CLIP-seq
MIRT2588340	hsa-miR-3922-3p	CLIP-seq
MIRT2588342	hsa-miR-3928	CLIP-seq
MIRT2588343	hsa-miR-3929	CLIP-seq
MIRT2588344	hsa-miR-3941	CLIP-seq
MIRT2588345	hsa-miR-4267	CLIP-seq
MIRT2588346	hsa-miR-4299	CLIP-seq
MIRT2588347	hsa-miR-4300	CLIP-seq
MIRT2588348	hsa-miR-4306	CLIP-seq
MIRT2588349	hsa-miR-4307	CLIP-seq
MIRT2588350	hsa-miR-4311	CLIP-seq
MIRT2687182	hsa-miR-432	CLIP-seq
MIRT2588351	hsa-miR-4330	CLIP-seq
MIRT2588352	hsa-miR-4419b	CLIP-seq
MIRT2588353	hsa-miR-4424	CLIP-seq
MIRT2588354	hsa-miR-4430	CLIP-seq
MIRT2588355	hsa-miR-4432	CLIP-seq
MIRT2588356	hsa-miR-4433	CLIP-seq
MIRT2588357	hsa-miR-4434	CLIP-seq
MIRT2687183	hsa-miR-4443	CLIP-seq
MIRT2061809	hsa-miR-4453	CLIP-seq
MIRT2588358	hsa-miR-4456	CLIP-seq
MIRT2588359	hsa-miR-4458	CLIP-seq
MIRT2588360	hsa-miR-4459	CLIP-seq
MIRT2588361	hsa-miR-4468	CLIP-seq
MIRT2588362	hsa-miR-4471	CLIP-seq
MIRT2588363	hsa-miR-4478	CLIP-seq
MIRT2588364	hsa-miR-4481	CLIP-seq
MIRT2588366	hsa-miR-4495	CLIP-seq
MIRT2588367	hsa-miR-4500	CLIP-seq
MIRT2588368	hsa-miR-4505	CLIP-seq
MIRT2588369	hsa-miR-4516	CLIP-seq
MIRT2588370	hsa-miR-451b	CLIP-seq
MIRT2588371	hsa-miR-4522	CLIP-seq
MIRT2588372	hsa-miR-4531	CLIP-seq
MIRT2061810	hsa-miR-4538	CLIP-seq
MIRT2588374	hsa-miR-4643	CLIP-seq
MIRT2588375	hsa-miR-4644	CLIP-seq
MIRT2588376	hsa-miR-4649-3p	CLIP-seq
MIRT2588377	hsa-miR-4653-3p	CLIP-seq
MIRT2588378	hsa-miR-466	CLIP-seq
MIRT2588379	hsa-miR-4672	CLIP-seq
MIRT2588380	hsa-miR-4680-5p	CLIP-seq
MIRT2588381	hsa-miR-4684-5p	CLIP-seq
MIRT2588382	hsa-miR-4689	CLIP-seq
MIRT1214693	hsa-miR-4693-3p	CLIP-seq
MIRT2588383	hsa-miR-4696	CLIP-seq
MIRT2588384	hsa-miR-4700-3p	CLIP-seq
MIRT2588386	hsa-miR-4709-3p	CLIP-seq
MIRT2588387	hsa-miR-4710	CLIP-seq
MIRT2588388	hsa-miR-4711-5p	CLIP-seq
MIRT2061811	hsa-miR-4722-5p	CLIP-seq
MIRT2588389	hsa-miR-4725-5p	CLIP-seq
MIRT1214694	hsa-miR-4727-3p	CLIP-seq
MIRT1214695	hsa-miR-4728-5p	CLIP-seq
MIRT2588390	hsa-miR-4739	CLIP-seq
MIRT2588391	hsa-miR-4745-5p	CLIP-seq
MIRT2588392	hsa-miR-4751	CLIP-seq
MIRT2588393	hsa-miR-4756-5p	CLIP-seq
MIRT2588394	hsa-miR-4758-5p	CLIP-seq
MIRT2588395	hsa-miR-4766-5p	CLIP-seq
MIRT2588396	hsa-miR-4768-3p	CLIP-seq
MIRT2588397	hsa-miR-4781-3p	CLIP-seq
MIRT2588398	hsa-miR-4784	CLIP-seq
MIRT2588399	hsa-miR-4789-3p	CLIP-seq
MIRT2588400	hsa-miR-485-5p	CLIP-seq
MIRT2588401	hsa-miR-488	CLIP-seq
MIRT2588402	hsa-miR-504	CLIP-seq
MIRT2588403	hsa-miR-516b	CLIP-seq
MIRT2588404	hsa-miR-526b	CLIP-seq
MIRT2588405	hsa-miR-541	CLIP-seq
MIRT1214703	hsa-miR-545	CLIP-seq
MIRT1214704	hsa-miR-548a-5p	CLIP-seq
MIRT1214705	hsa-miR-548ab	CLIP-seq
MIRT1214706	hsa-miR-548ak	CLIP-seq
MIRT1214707	hsa-miR-548b-5p	CLIP-seq
MIRT1214708	hsa-miR-548c-5p	CLIP-seq
MIRT1214709	hsa-miR-548d-5p	CLIP-seq
MIRT1214710	hsa-miR-548h	CLIP-seq
MIRT1214711	hsa-miR-548i	CLIP-seq
MIRT1214712	hsa-miR-548j	CLIP-seq
MIRT2687184	hsa-miR-548n	CLIP-seq
MIRT2588406	hsa-miR-548q	CLIP-seq
MIRT2588407	hsa-miR-548v	CLIP-seq
MIRT1214713	hsa-miR-548w	CLIP-seq
MIRT1214714	hsa-miR-548y	CLIP-seq
MIRT1214715	hsa-miR-559	CLIP-seq
MIRT2588409	hsa-miR-569	CLIP-seq
MIRT1214734	hsa-miR-577	CLIP-seq
MIRT2588411	hsa-miR-593	CLIP-seq
MIRT2588412	hsa-miR-604	CLIP-seq
MIRT2588413	hsa-miR-618	CLIP-seq
MIRT1214718	hsa-miR-619	CLIP-seq
MIRT2588414	hsa-miR-647	CLIP-seq
MIRT2588415	hsa-miR-653	CLIP-seq
MIRT2588416	hsa-miR-654-5p	CLIP-seq
MIRT2588417	hsa-miR-657	CLIP-seq
MIRT2687185	hsa-miR-765	CLIP-seq
MIRT2588418	hsa-miR-920	CLIP-seq
MIRT2588419	hsa-miR-92a	CLIP-seq
MIRT2588420	hsa-miR-92b	CLIP-seq
MIRT2588421	hsa-miR-940	CLIP-seq
MIRT2588422	hsa-miR-98	CLIP-seq

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IMP	28525742
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	16061477
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	IGI	26479788
GO:0002376	Process	Immune system process	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IMP	16061477
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IBA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IDA	23230272
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IMP	16061477
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS
GO:0004857	Function	Enzyme inhibitor activity	IDA	27796300
GO:0005515	Function	Protein binding	IPI	16809771, 23230272, 26479788, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	16061477
GO:0005634	Component	Nucleus	IDA	26479788
GO:0005634	Component	Nucleus	IDA	16809771, 23230272
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	11110709
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	16809771, 23230272, 26479788, 27796300
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006302	Process	Double-strand break repair	IMP	23230272
GO:0006974	Process	DNA damage response	IEA
GO:0010608	Process	Post-transcriptional regulation of gene expression	IMP	26479788
GO:0010629	Process	Negative regulation of gene expression	IBA
GO:0010629	Process	Negative regulation of gene expression	IMP	27796300
GO:0016020	Component	Membrane	HDA	19946888
GO:0016477	Process	Cell migration	TAS	11110709
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0019082	Process	Viral protein processing	TAS
GO:0019899	Function	Enzyme binding	IPI	27796300
GO:0032991	Component	Protein-containing complex	IDA	26479788
GO:0034355	Process	NAD+ biosynthetic process via the salvage pathway	TAS
GO:0035563	Process	Positive regulation of chromatin binding	IGI	26479788
GO:0042393	Function	Histone binding	IPI	26479788
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IMP	27796300
GO:0043086	Process	Negative regulation of catalytic activity	IDA	27796300
GO:0044389	Function	Ubiquitin-like protein ligase binding	IBA
GO:0044389	Function	Ubiquitin-like protein ligase binding	IPI	28525742
GO:0045087	Process	Innate immune response	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IGI	26479788
GO:0051607	Process	Defense response to virus	IEA
GO:0060330	Process	Regulation of response to type II interferon	IDA	16809771
GO:0060334	Process	Regulation of type II interferon-mediated signaling pathway	IEA
GO:0060335	Process	Positive regulation of type II interferon-mediated signaling pathway	IBA
GO:0060335	Process	Positive regulation of type II interferon-mediated signaling pathway	IEA
GO:0060335	Process	Positive regulation of type II interferon-mediated signaling pathway	IMP	27796300
GO:0070212	Process	Protein poly-ADP-ribosylation	IMP	16061477
GO:0070403	Function	NAD+ binding	IMP	16061477
GO:0072570	Function	ADP-D-ribose binding	IMP	26479788
GO:0090734	Component	Site of DNA damage	IDA	28525742
GO:0097677	Function	STAT family protein binding	IPI	26479788
GO:0140802	Function	NAD+-protein-C-terminal glycine ADP-ribosyltransferase activity	IDA	28525742
GO:0140802	Function	NAD+-protein-C-terminal glycine ADP-ribosyltransferase activity	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IGI	26479788

MIM	HGNC	e!Ensembl
612065	24118	ENSG00000138496

Q8IXQ6

Protein name

Protein mono-ADP-ribosyltransferase PARP9 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 9) (ARTD9) (B aggressive lymphoma protein) (Poly [ADP-ribose] polymerase 9) (PARP-9)

Protein function

ADP-ribosyltransferase which, in association with E3 ligase DTX3L, plays a role in DNA damage repair and in immune responses including interferon-mediated antiviral defenses (PubMed:16809771, PubMed:23230272, PubMed:26479788, PubMed:27796300). W

PDB

5AIL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01661	Macro	136 → 255	Macro domain	Domain
PF01661	Macro	335 → 446	Macro domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lymphocyte-rich tissues, spleen, lymph nodes, peripheral blood lymphocytes and colonic mucosa (PubMed:11110709, PubMed:16809771). Expressed in macrophages (PubMed:27796300). Also expressed in nonhematopoietic tissues such

Sequence

MDFSMVAGAAAYNEKSGRITSLSLLFQKVFAQIFPQWRKGNTEECLPYKCSETGALGENY
SWQIPINHNDFKILKNNERQLCEVLQNKFGCISTLVSPVQEGNSKSLQVFRKMLTPRIEL
SVWKDDLTTHAVDAVVNAANEDLLHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEI
AVTGAGRLPCKQIIHAVGPRWMEWDKQGCTGKLQRAIVSILNYVIYKNTHIKTVAIPALS
SGIFQFPLNLCTKTIVETIRVSLQGKPMMSNLKEIHLVSNEDPTVAAFKAASEFILGKSE
LGQETTPSFNAMVVNNLTLQIVQGHIEWQTADVIVNSVNPHDITVGPVAKSILQQAGVEM
KSEFLATKAKQFQRSQLVLVTKGFNLFCKYIYHVLWHSEFPKPQILKHAMKECLEKCIEQ
NITSISFPALGTGNMEIKKETAAEILFDEVLTFAKDHVKHQLTVKFVIFPTDLEIYKAFS
SEMAKRSKMLSLNNYSVPQSTREEKRENGLEARSPAINLMGFNVEEMYEAHAWIQRILSL
QNHHIIENNHILYLGRKEHDILSQLQKTSSVSITEIISPGRTELEIEGARADLIEVVMNI
EDMLCKVQEEMARKKERGLWRSLGQWTIQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQ
FEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGF
QRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIV
PPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFA
QHPWRGFASGSPVD

Sequence length

854

Interactions

View interactions

	Reactome
			Nicotinamide salvaging

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (76)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22898323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	22898323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22898323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	16061477, 23487038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	9442347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12952249, 20003105, 23647087, 28300572, 28933920, 30290132, 30352167, 30576223, 30861490, 31019244, 31161938, 31532863, 7742019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34494468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11110709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	10909128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30128030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36766731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40707929	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	30281324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22898323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23487038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17505034, 21818276, 29750543, 30641028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35593226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20456672, 29232160, 29327941, 30032860, 30281324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	30141971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16061477, 16809771, 23487038, 24886089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	29063135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	29493871, 30107039, 31019244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	9686422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32678519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	10211889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	1954982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	12100034, 21649933, 27769060, 28057004, 30141961, 30789747, 31051082, 31098385, 31106564, 31678459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	11948049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34948292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal cleft	Laryngeal cleft	BEFREE	28910519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22898323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	30429396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	11110709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23387413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	24074287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	23387413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	23387413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	10378572, 22738791, 31577091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28202030, 30168753, 31577091, 31678459, 8769489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21437871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	31669429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16809771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29477363, 30128030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	21757570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30128030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30128030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11035700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	10909128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	24886089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	31440254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	21757570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16809771, 23487038, 24886089, 30128030, 31774223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine cell hyperplasia of infancy	Neuroendocrine Cell Hyperplasia	BEFREE	31409098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	30429396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	24874501, 29672122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28957638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	10211889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Porphyria, Erythropoietic	Congenital erythropoietic porphyria	BEFREE	30612125, 31253537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	24068019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30128030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24886089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	10779401, 15182285, 31002528, 31229291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	34133010	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	29206477, 31253537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20966039, 27769060, 30240278, 30982371, 31678459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	30990758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30297333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	17052298, 28057004, 28846439, 29242257, 30141971, 30612125, 31678459, 8120402, 8769489, 8893383, 9572000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	2710120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11121180, 7909989, 8678117, 9702743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Simple Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	12684329, 30612125, 31253537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	26857698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38182103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39739965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11407697, 7735620		★★★★★ ★☆☆☆☆ Found in Text Mining only

PARP9 (poly(ADP-ribose) polymerase family member 9)