Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	83648
Gene name	Family with sequence similarity 167 member A
Gene symbol	FAM167A
Synonyms (NCBI Gene)	C8orf13D8S265DIORA-1
Chromosome	8
Chromosome location	8p23.1

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs886037620	G>A	Pathogenic	Intron variant, genic upstream transcript variant

127

Show/Hide all (127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023167	hsa-miR-124-3p	Microarray	18668037
MIRT024071	hsa-miR-1-3p	Microarray	18668037
MIRT981608	hsa-miR-1207-5p	CLIP-seq
MIRT981609	hsa-miR-1299	CLIP-seq
MIRT981610	hsa-miR-142-5p	CLIP-seq
MIRT981611	hsa-miR-146b-3p	CLIP-seq
MIRT981612	hsa-miR-147	CLIP-seq
MIRT981613	hsa-miR-1537	CLIP-seq
MIRT981614	hsa-miR-2117	CLIP-seq
MIRT981615	hsa-miR-2278	CLIP-seq
MIRT981616	hsa-miR-3126-3p	CLIP-seq
MIRT981617	hsa-miR-3151	CLIP-seq
MIRT981618	hsa-miR-3173-5p	CLIP-seq
MIRT981619	hsa-miR-320a	CLIP-seq
MIRT981620	hsa-miR-320b	CLIP-seq
MIRT981621	hsa-miR-320c	CLIP-seq
MIRT981622	hsa-miR-320d	CLIP-seq
MIRT981623	hsa-miR-3606	CLIP-seq
MIRT981624	hsa-miR-3650	CLIP-seq
MIRT981625	hsa-miR-3651	CLIP-seq
MIRT981626	hsa-miR-3911	CLIP-seq
MIRT981627	hsa-miR-3978	CLIP-seq
MIRT981628	hsa-miR-411	CLIP-seq
MIRT981629	hsa-miR-4263	CLIP-seq
MIRT981630	hsa-miR-4429	CLIP-seq
MIRT981631	hsa-miR-4447	CLIP-seq
MIRT981632	hsa-miR-4455	CLIP-seq
MIRT981633	hsa-miR-4472	CLIP-seq
MIRT981634	hsa-miR-4643	CLIP-seq
MIRT981635	hsa-miR-4680-3p	CLIP-seq
MIRT981636	hsa-miR-4719	CLIP-seq
MIRT981637	hsa-miR-4736	CLIP-seq
MIRT981638	hsa-miR-4753-3p	CLIP-seq
MIRT981639	hsa-miR-4763-3p	CLIP-seq
MIRT981640	hsa-miR-491-5p	CLIP-seq
MIRT981641	hsa-miR-513b	CLIP-seq
MIRT981642	hsa-miR-561	CLIP-seq
MIRT981643	hsa-miR-576-5p	CLIP-seq
MIRT981644	hsa-miR-583	CLIP-seq
MIRT981645	hsa-miR-642b	CLIP-seq
MIRT981646	hsa-miR-644	CLIP-seq
MIRT981647	hsa-miR-651	CLIP-seq
MIRT981648	hsa-miR-874	CLIP-seq
MIRT981649	hsa-miR-875-3p	CLIP-seq
MIRT981650	hsa-miR-921	CLIP-seq
MIRT1990794	hsa-miR-1205	CLIP-seq
MIRT1990795	hsa-miR-1246	CLIP-seq
MIRT1990796	hsa-miR-128	CLIP-seq
MIRT1990797	hsa-miR-1286	CLIP-seq
MIRT1990798	hsa-miR-1470	CLIP-seq
MIRT1990799	hsa-miR-216a	CLIP-seq
MIRT1990800	hsa-miR-224	CLIP-seq
MIRT1990801	hsa-miR-2392	CLIP-seq
MIRT1990802	hsa-miR-24	CLIP-seq
MIRT1990803	hsa-miR-2467-5p	CLIP-seq
MIRT1990804	hsa-miR-27a	CLIP-seq
MIRT1990805	hsa-miR-27b	CLIP-seq
MIRT1990806	hsa-miR-3134	CLIP-seq
MIRT981617	hsa-miR-3151	CLIP-seq
MIRT1990807	hsa-miR-3185	CLIP-seq
MIRT1990808	hsa-miR-3664-3p	CLIP-seq
MIRT981628	hsa-miR-411	CLIP-seq
MIRT1990809	hsa-miR-4257	CLIP-seq
MIRT1990810	hsa-miR-4290	CLIP-seq
MIRT1990811	hsa-miR-4330	CLIP-seq
MIRT981631	hsa-miR-4447	CLIP-seq
MIRT981633	hsa-miR-4472	CLIP-seq
MIRT1990812	hsa-miR-4645-5p	CLIP-seq
MIRT1990813	hsa-miR-4673	CLIP-seq
MIRT1990814	hsa-miR-4690-3p	CLIP-seq
MIRT1990815	hsa-miR-4695-5p	CLIP-seq
MIRT1990816	hsa-miR-4704-3p	CLIP-seq
MIRT1990817	hsa-miR-4722-5p	CLIP-seq
MIRT1990818	hsa-miR-4726-3p	CLIP-seq
MIRT1990819	hsa-miR-4749-3p	CLIP-seq
MIRT1990820	hsa-miR-4763-5p	CLIP-seq
MIRT1990821	hsa-miR-4768-3p	CLIP-seq
MIRT981640	hsa-miR-491-5p	CLIP-seq
MIRT1990822	hsa-miR-572	CLIP-seq
MIRT1990823	hsa-miR-596	CLIP-seq
MIRT1990824	hsa-miR-604	CLIP-seq
MIRT1990825	hsa-miR-647	CLIP-seq
MIRT1990826	hsa-miR-766	CLIP-seq
MIRT1990827	hsa-miR-935	CLIP-seq
MIRT1990828	hsa-miR-936	CLIP-seq
MIRT981612	hsa-miR-147	CLIP-seq
MIRT981615	hsa-miR-2278	CLIP-seq
MIRT981617	hsa-miR-3151	CLIP-seq
MIRT981619	hsa-miR-320a	CLIP-seq
MIRT981620	hsa-miR-320b	CLIP-seq
MIRT981621	hsa-miR-320c	CLIP-seq
MIRT981622	hsa-miR-320d	CLIP-seq
MIRT981624	hsa-miR-3650	CLIP-seq
MIRT2225039	hsa-miR-3688-3p	CLIP-seq
MIRT2225040	hsa-miR-376a	CLIP-seq
MIRT2225041	hsa-miR-376b	CLIP-seq
MIRT981626	hsa-miR-3911	CLIP-seq
MIRT981630	hsa-miR-4429	CLIP-seq
MIRT981631	hsa-miR-4447	CLIP-seq
MIRT981632	hsa-miR-4455	CLIP-seq
MIRT981633	hsa-miR-4472	CLIP-seq
MIRT981635	hsa-miR-4680-3p	CLIP-seq
MIRT981636	hsa-miR-4719	CLIP-seq
MIRT981640	hsa-miR-491-5p	CLIP-seq
MIRT981641	hsa-miR-513b	CLIP-seq
MIRT981646	hsa-miR-644	CLIP-seq
MIRT1990827	hsa-miR-935	CLIP-seq
MIRT2387740	hsa-miR-1293	CLIP-seq
MIRT981612	hsa-miR-147	CLIP-seq
MIRT981617	hsa-miR-3151	CLIP-seq
MIRT2387741	hsa-miR-34a	CLIP-seq
MIRT2387742	hsa-miR-34c-5p	CLIP-seq
MIRT981624	hsa-miR-3650	CLIP-seq
MIRT981626	hsa-miR-3911	CLIP-seq
MIRT2387743	hsa-miR-4273	CLIP-seq
MIRT2387744	hsa-miR-4436a	CLIP-seq
MIRT981631	hsa-miR-4447	CLIP-seq
MIRT981632	hsa-miR-4455	CLIP-seq
MIRT981633	hsa-miR-4472	CLIP-seq
MIRT2387745	hsa-miR-4483	CLIP-seq
MIRT2387746	hsa-miR-449a	CLIP-seq
MIRT2387747	hsa-miR-449b	CLIP-seq
MIRT981636	hsa-miR-4719	CLIP-seq
MIRT981640	hsa-miR-491-5p	CLIP-seq
MIRT981641	hsa-miR-513b	CLIP-seq
MIRT981646	hsa-miR-644	CLIP-seq
MIRT2465251	hsa-miR-4497	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 31515488, 32296183, 32814053, 33961781

MIM	HGNC	e!Ensembl
610085	15549	ENSG00000154319

Q96KS9

Protein name

Protein FAM167A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11652	FAM167	130 → 214	FAM167	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in skin, including primary keratinocytes, spleen, kidney, leukocytes, testis, lung, small intestine and prostate. {ECO:0000269|PubMed:11896452}.

Sequence

MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPF
PRPAAEPQASLEEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAI
AWLRKELTEMRLQDQQLARQLMRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADL
FCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC

Sequence length

214

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 11	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult type dermatomyositis	Dermatomyositis	BEFREE	24632671, 25846585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	27088737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21765104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27088737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23635951, 23899688, 27105348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24632671, 29207374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33510822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	23899688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	15111509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	24632671, 25846585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	24632671, 25846585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	21765104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	GWASDB_DG	22960999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	20156505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	25846585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	25846585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21792837, 24702955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18204098, 19180478, 19442287, 19796918, 20131239, 21765104, 21792837, 23049788, 28289186, 29070082, 34952359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21792837, 24702955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18204098, 19180478, 19796918, 19838192, 20131239, 21765104, 21792837, 24702955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	23049788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	23049788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21792837, 24702955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity-onset diabetes of the young, type 11	Mason type diabetes	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21765104		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	Pubtator	25846585	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	23899688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	24632671, 25846585		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymyositis	Polymyositis	Pubtator	24632671, 25846585	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21765104		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	19796918, 20131239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	19714582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	19714582, 24097067, 29070082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19796918, 20131239, 21480188, 23899688, 25470816		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

FAM167A (family with sequence similarity 167 member A)